Skip to main content

MS Plotting utilities

These scripts provide some simple utilities for mining and plotting MS data. The data is expected to be available in mzML or the openMS featureXML format.

Script files can be run as standalone apps or as a library.

MSPlot.msplot3d

Command Line Usage: msplot3d.py [options]

Options:
-h, --help

show this help message and exit

-m MZML, --mzml=MZML

Input mzML file

-f FEATURE, --feature=FEATURE

comma separated list of featureXML files

-o OUTFILE, --output=OUTFILE

output filename (default=’plot.pdf’)

-s, --showX11

Show X11 interactive plot.

-x XROT, --xrot=XROT

Xaxis rotation for plot (default (30)

-y YROT, --yrot=YROT

Yaxis rotation for plot (default: -45)

-l CLIP, --limit=CLIP

Clip threshold for plot

-c COLOURS, --colours=COLOURS

list of colours with which to plot features. Colours will be recycled when needed (default=’r,g,m,c,y,k’)

-r RTMIN, --rtmin=RTMIN

minimum retention time

-R RTMAX, --rtmax=RTMAX

maximum retention time

-t MZMIN, --mzmin=MZMIN

minimum m/z value

-T MZMAX, --mzmax=MZMAX

maximum m/z value

-w RTWINDOW, --rtwindow=RTWINDOW

Window around plot area in which to identify feature peaks

-p, --plotms2

Plot MS2 events

-d MS2WIN, --ms2win=MS2WIN

MS2 ion capture window size

Module usage: mzml is the only non-named argument. All arguments as per the command line version except that lists should be provided as arrays rather than comma-delimited text.

>>> import MSPlot.msplot3d
>>> MSPlot.plot3d(mzml, featfiles=[], outfile='plot.pdf', show=False, xrot=30, yrot=-45, featcols=['r','g','b','m','c','k'], thresh=100, minrt=None,maxrt=None,minmz=None, maxmz=None, ms2win=2.0, rtwindow=20.0, plotms2=True)

MSPlot.ms1pep

Module Usage:

>>> import Unimod.unimod
>>> import MSPlot.ms1pep
>>> peptide='ACDEFGHIKLMNPQRSTVWYKKACDPRFGHI'
# protein amino acid sequence
>>> frags=MSPlot.ms1pep.digestprotein(peptide, enzyme=1, overlap=True, unfavoured=False)
    # overlap - include 1 missed cleavage
    # unfavoured - include unfavourable sites (see the EMBOSS documentation for more details)
    # enzyme - numerical enzyme selection according to the EMBOSS documentation
    Enzymes and Reagents
         1 : Trypsin
         2 : Lys-C
         3 : Arg-C
         4 : Asp-N
         5 : V8-bicarb
         6 : V8-phosph
         7 : Chymotrypsin
         8 : CNBr
>>> frags
[{'start': '1', 'end': '15', 'sequence': 'ACDEFGHIKLMNPQR'}, {'start': '16', 'end': '23', 'sequence': 'STVWYKK'}, {'start': '24', 'end': '32', 'sequence': 'ACDPRFGHI'}, {'start': '1', 'end': '23', 'sequence': 'ACDEFGHIKLMNPQRSTVWYKK'}]
# list of digested fragment peptides.
>>> camc=Unimod.unimod.database.get_label('Carbamidomethyl')['delta_mono_mass']
# get delta mass for fixed cysteine modification.
>>> MSPlot.ms1pep.listmz(frags[0]['sequence'], charges=[2,3,4], modifications=[], fixedmods={'C': camc })
[908.43562931579208, 605.95969455552802, 454.72172717539604]
# returns a list of mz values
>>> mzlist=MSPlot.ms1pep.listmz(frags[1]['sequence'], charges=[2,3,4], modifications=['2 Phospho (T)',], fixedmods={'C': camc })
>>> mzlist
[536.7538243454826, 358.17182457532175, 268.8808246902413]

# listmz does not permute, so for variable modifications, call it with each permutation.

>>> xics=MSPlot.ms1pep.getXIC("LCMSrun.mzML", mzlist, tolerance=0.01, minrt=0, maxrt=None)
>>> xics.keys()
['rt', '358.171824575', '536.753824345', '268.88082469']
# extracts the XIC for each mz ratio. The keys are a truncated string version of the full precision calculated mass.

MSPlot.ms1pep.plotXIC(xics, colours=[‘r’,’g’,’b’,’m’,’c’,’k’], outfile=”plot.pdf”, title=”XIC plot”): # plot the XICs. Any number can be plotted, but they are separated by 7% max(XIC)

Dependencies

pyMS - OpenMS data parsing and analysis by Niek de Klein pymzml - mzML parsing library pyteomics - package for calculating mz values and more numpy - large scale data handling matplotlib - plotting library EMBOSS (for the digest application) Unimod - module for handling a Unimod database.

Author

Dr David Martin, University of Dundee d.m.a.martin@dundee.ac.uk

Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

MSPlot-0.1.3.5j.tar.gz (26.3 kB view details)

Uploaded Source

File details

Details for the file MSPlot-0.1.3.5j.tar.gz.

File metadata

  • Download URL: MSPlot-0.1.3.5j.tar.gz
  • Upload date:
  • Size: 26.3 kB
  • Tags: Source
  • Uploaded using Trusted Publishing? No

File hashes

Hashes for MSPlot-0.1.3.5j.tar.gz
Algorithm Hash digest
SHA256 d04b1ad9668b58215e3400f7ec72c803476251c01695d76ac1e15b4c8e1e65f1
MD5 dcd10cab57bc2a652e74b04947c53ed5
BLAKE2b-256 41890c3dfcaf1180324e21c5ea485b18ffd4f63ed588de361fb2d20364b0a4af

See more details on using hashes here.

Release history Release notifications | RSS feed

This release

0.1.3.5j This release

1 file

Anthropic, PBC Visionary sponsor Bloomberg Visionary sponsor Hudson River Trading Visionary sponsor Meta Visionary sponsor NVIDIA Visionary sponsor Microsoft Sustainability sponsor Depot Continuous Integration AWS Cloud computing and Security Sponsor Datadog Monitoring Fastly CDN Google Download Analytics Sentry Error logging StatusPage Status page