Protein prediction package
Project description
ProTstab2
Protein prediction package
Environmental installation
Model Download
You can download the model in the following two ways:
- https://drive.google.com/drive/folders/1OEKabeJmdGiGG1PJsPu0bgcE5_GVGXc9?usp=share_link
- https://luke9012.lanzoub.com/b00r1vhre | password:ddpt
After the download is completed, pass in the folder path
p = ProTstab2(r'D:\_code\_github\ProTstab2\drop')
R
R language version requires version 4.1.3 or higher Two packages need to be installed simultaneously:
install.packages("protr")
install.packages("DT")
Set SimultaneouslyR_HOME
to environment variable
Python
Python version requires3.6
or higher
How to use
If there is a protein sequence
name = "Q4JB77"
seq = "MRAAVLEEYKKPLRISEVDSPSINESSEVLLQVTATGLCHGDIHIAMGEWDSQIQVNLPIILGHEVVGRVLQSNHDKIKKNDLVLVYNAFGCKNCKYCKFKEYQFCEKVKVIGVNLNGGFAEYVKIPDGDNLVRVNTSDPIKLAPLADAGLTAYNSVKDLEENSKVLIIGTGAVALIALQLLKLKNVDVTVIGENQLKLDSAEKLGADEVISIKREEDSYLSLLPGKKFDYILDYVGSTRTLAESPWLLNKKGELRIIGEFGGVLRAEEQLLVLRGLRIRGILYGSLQDLKHILDIYLKGKIDTLTTVYKLEDINEAITDVTEGKVVGRAVIVP"
p = ProTstab2(r'D:\_code\_github\ProTstab2\drop')
r, r2 = p.predict(name, seq)
print(r, r2)
# 0.8722285 Thermophilic protein
If there is no protein sequence, the following methods can be used
Method 1:
name = "Q4JB77"
p = ProTstab2(r'D:\_code\_github\ProTstab2\drop')
seq = p.get_seq_info(name)
r, r2 = p.predict(name, seq)
print(r, r2)
# 0.8722285 Thermophilic protein
Method 2:
name = "Q4JB77"
p = ProTstab2(r'D:\_code\_github\ProTstab2\drop')
r, r2 = p.predict(name)
print(r, r2)
# 0.8722285 Thermophilic protein
The first method is recommended here for the following reasons:
- Due to the use of crawlers, it is not guaranteed that data can be obtained every time, and the program may crash
- You can obtain specific protein sequence values
Disclaimers
The applications involved in this package are for learning and communication purposes only and shall not be used for any commercial purposes. Any legal disputes arising from this have nothing to do with me!
Project details
Download files
Download the file for your platform. If you're not sure which to choose, learn more about installing packages.