Skip to main content

No project description provided

Project description

afrc

Documentation Status

AFRC logo

About

What?

afrc is a Python package that implements an analytical version of the Flory Random Coil (i.e. the AFRC) for polypeptides. By way of an example, if you have a protein sequence, one can calculate a variety of polymeric properties simply by passing in the sequence:

from afrc import AnalyticalFRC

# creat an AnalyticalFRC object
P = AnalyticalFRC('MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDI')

## from this object you can calculate various polymeric properties
## directly without any additional information

# get the ensemble-average radius of gyration
mean_rg = P.get_mean_radius_of_gyration()

# get the ensemble-average end-to-end distance
mean_e2e = P.get_mean_end_to_end_distance()

# get the full distribution of the radius of gyration
[bins, p_rg] = P.get_radius_of_gyration_distribution()

# get the full distribution of the distances between residue 4 and 20
[bins, p_r] = P.get_interresidue_distance_distribution(4,20)

Why?

When studying disordered or unfolded polypeptides we often lack a relevant "reference" frame to calibrate our expectations or results. The AFRC provides a pre-parameterized model that recapitulates a polypeptide in a theta solvent. A theta solvent is a solvent where chain-chain and chain-solvent are equally attractive, canceling out excluded volume effects, giving rise to a chain with a polymer scaling exponent of 0.5.

How?

Read the preprint! But the TL/DR is we performed numerical simulations to generate Flory Random Coil ensembles (see Mao et al

Who?

The AFRC was developed by Garrett, Jhullian and Alex in the Holehouse lab. For any questions please contact Alex.

Implementation details

This analytical solution is based on the rotational isomeric state approximation of Flory and Volkenstein and parameterized using numerical simulations of residue-specific Flory Random Coil. It provides an interface into sequence-specific polymeric properties (i.e. intra-molecular distances) expected for a given sequence and behaves like a polymer in a true theta solvent. In this way it provides a convenient reference state though which real simulations or experiments can be normalized against.

Installation

To install afrc:

pip install afrc 

Quickstart

There is a single user-facing object that is built from the afrc package which is the AnalyticalFRC object. This object gives access to a bunch of additional object functions. As an example

from afrc import AnalyticalFRC

A = AnalyticalFRC('APPAPAPAPPAPAPAPPAPPAPPAPAPPA')

# prints the expected radius of gyration if the associated sequence 
# behaved like a bona fide Flory Random Coil
print(A.get_mean_radius_of_gyration())  

# prints the expected end-to-end distance if the associated sequence 
# behaved like a bona fide Flory Random Coil
print(A.get_mean_end_to_end_distance())

Documentation

For full documentation, see here

Help

If you find a bug or have any feature requests please submit an issue here on GitHub. Also feel free to shoot Alex an email

License

The afrc package is distributed by the Holehouse Lab under the GNU LESSER GENERAL PUBLIC LICENSE.

Project details


Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

afrc-0.3.2.tar.gz (56.9 kB view hashes)

Uploaded Source

Supported by

AWS AWS Cloud computing and Security Sponsor Datadog Datadog Monitoring Fastly Fastly CDN Google Google Download Analytics Microsoft Microsoft PSF Sponsor Pingdom Pingdom Monitoring Sentry Sentry Error logging StatusPage StatusPage Status page