Skip to main content

Atomic AI – An attempt at a minimalist, flexible deep learning framework for diverse models.

Project description

atai

Atomic AI is a flexible, minimalist deep neural network training framework based on Jeremy Howard’s miniai from the fast.ai 2022 course.

Install

pip install atai

How to use

from atai.core import *

The following example demonstrates how the Atomic AI training framework can be used to train a custom model that predicts protein solubility.

Imports

import torch
import torch.nn.functional as F
import torch.nn as nn
from torch.nn import init
from torch import optim

from torcheval.metrics import BinaryAccuracy, BinaryAUROC
from torcheval.metrics.functional import binary_auroc, binary_accuracy
from torchmetrics.classification import BinaryMatthewsCorrCoef
from torchmetrics.functional.classification import binary_matthews_corrcoef

import fastcore.all as fc
from functools import partial

Load Protein Solubility

This example uses the dataset from the DeepSol paper by Khurana et al. which was obtained at https://zenodo.org/records/1162886. It consists of amino acid sequences of peptides along with solubility labels that are 1 if the peptide is soluble and 0 if the peptide is insoluble.

train_sqs = open('sol_data/train_src', 'r').read().splitlines()
train_tgs = list(map(int, open('sol_data/train_tgt', 'r').read().splitlines()))

valid_sqs = open('sol_data/val_src', 'r').read().splitlines()
valid_tgs = list(map(int, open('sol_data/val_tgt', 'r').read().splitlines()))

train_sqs[:2], train_tgs[:2]
(['GMILKTNLFGHTYQFKSITDVLAKANEEKSGDRLAGVAAESAEERVAAKVVLSKMTLGDLRNNPVVPYETDEVTRIIQDQVNDRIHDSIKNWTVEELREWILDHKTTDADIKRVARGLTSEIIAAVTKLMSNLDLIYGAKKIRVIAHANTTIGLPGTFSARLQPNHPTDDPDGILASLMEGLTYGIGDAVIGLNPVDDSTDSVVRLLNKFEEFRSKWDVPTQTCVLAHVKTQMEAMRRGAPTGLVFQSIAGSEKGNTAFGFDGATIEEARQLALQSGAATGPNVMYFETGQGSELSSDAHFGVDQVTMEARCYGFAKKFDPFLVNTVVGFIGPEYLYDSKQVIRAGLEDHFMGKLTGISMGCDVCYTNHMKADQNDVENLSVLLTAAGCNFIMGIPHGDDVMLNYQTTGYHETATLRELFGLKPIKEFDQWMEKMGFSENGKLTSRAGDASIFLK',
  'MAHHHHHHMSFFRMKRRLNFVVKRGIEELWENSFLDNNVDMKKIEYSKTGDAWPCVLLRKKSFEDLHKLYYICLKEKNKLLGEQYFHLQNSTKMLQHGRLKKVKLTMKRILTVLSRRAIHDQCLRAKDMLKKQEEREFYEIQKFKLNEQLLCLKHKMNILKKYNSFSLEQISLTFSIKKIENKIQQIDIILNPLRKETMYLLIPHFKYQRKYSDLPGFISWKKQNIIALRNNMSKLHRLY'],
 [1, 0])
len(train_sqs), len(train_tgs), len(valid_sqs), len(valid_tgs)
(62478, 62478, 6942, 6942)

Data Preparation

Create a sorted list of amino acid sequences aas including an empty string for padding and determine the size of the vocabulary.

aas = sorted(list(set("".join(train_sqs))) + [""])
vocab_size = len(aas)
aas, vocab_size
(['',
  'A',
  'C',
  'D',
  'E',
  'F',
  'G',
  'H',
  'I',
  'K',
  'L',
  'M',
  'N',
  'P',
  'Q',
  'R',
  'S',
  'T',
  'V',
  'W',
  'Y'],
 21)

Create dictionaries that translate between string and integer representations of amino acids and define the corresponding encode and decode functions.

str2int = {aa:i for i, aa in enumerate(aas)}
int2str = {i:aa for i, aa in enumerate(aas)}
encode = lambda s: [str2int[aa] for aa in s]
decode = lambda l: ''.join([int2str[i] for i in l])

print(encode("AYWCCCGGGHH"))
print(decode(encode("AYWCCCGGGHH")))
[1, 20, 19, 2, 2, 2, 6, 6, 6, 7, 7]
AYWCCCGGGHH

Figure out what the range of lengths of amino acid sequences in the dataset is.

train_lens = list(map(len, train_sqs))
min(train_lens), max(train_lens)
(19, 1691)

Create a function that drops all sequences above a chosen threshold and also returns a list of indices of the sequences that meet the threshold that can be used to obtain the correct labels.

def drop_long_sqs(sqs, threshold=1200):
    new_sqs = []
    idx = []
    for i, sq in enumerate(sqs):
        if len(sq) <= threshold:
            new_sqs.append(sq)
            idx.append(i)
    return new_sqs, idx

Drop all sequences above your chosen threshold.

trnsqs, trnidx = drop_long_sqs(train_sqs, threshold=200)
vldsqs, vldidx = drop_long_sqs(valid_sqs, threshold=200)
len(trnidx), len(vldidx)
(18066, 1971)
max(map(len, trnsqs))
200

Create a function for zero padding all sequences.

def zero_pad(sq, length=1200):
    new_sq = sq.copy()
    if len(new_sq) < length:
        new_sq.extend([0] * (length-len(new_sq)))
    return new_sq

Now encode and zero pad all sequences and make sure that it worked out correctly.

trn = list(map(encode, trnsqs))
vld = list(map(encode, vldsqs))
print(f"Length of the first two sequences before zero padding: {len(trn[0])}, {len(trn[1])}")
trn = list(map(partial(zero_pad, length=200), trn))
vld = list(map(partial(zero_pad, length=200), vld))
print(f"Length of the first two sequences after zero padding:  {len(trn[0])}, {len(trn[1])}");
Length of the first two sequences before zero padding: 116, 135
Length of the first two sequences after zero padding:  200, 200

Convert the data to torch.tensors unsing dtype=torch.int64 and check for correctness.

trntns = torch.tensor(trn, dtype=torch.int64)
vldtns = torch.tensor(vld, dtype=torch.int64)
trntns.shape, trntns[0]
(torch.Size([18066, 200]),
 tensor([11,  9,  1, 10,  2, 10, 10, 10, 10, 13, 18, 10,  6, 10, 10, 18, 16, 16,  9, 17, 10,  2, 16, 11,  4,  4,  1,  8, 12,  4, 15,  8, 14,
          4, 18,  1,  6, 16, 10,  8,  5, 15,  1,  8, 16, 16,  8,  6, 10,  4,  2, 14, 16, 18, 17, 16, 15,  6,  3, 10,  1, 17,  2, 13, 15,  6,
          5,  1, 18, 17,  6,  2, 17,  2,  6, 16,  1,  2,  6, 16, 19,  3, 18, 15,  1,  4, 17, 17,  2,  7,  2, 14,  2,  1,  6, 11,  3, 19, 17,
          6,  1, 15,  2,  2, 15, 18, 14, 13, 10,  4,  7,  7,  7,  7,  7,  7,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,
          0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,
          0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,
          0,  0]))
trntns.shape, vldtns.shape
(torch.Size([18066, 200]), torch.Size([1971, 200]))

Obtain the correct labels using the lists of indices obtained from the drop_long_sqs function and convert the lists of labels to tensors in torch.float32 format.

trnlbs = torch.tensor(train_tgs, dtype=torch.float32)[trnidx]
vldlbs = torch.tensor(valid_tgs, dtype=torch.float32)[vldidx]
trnlbs.shape, vldlbs.shape
(torch.Size([18066]), torch.Size([1971]))

Calculate the ratios of soluble peptides in the train and valid data.

trnlbs.sum().item()/trnlbs.shape[0], vldlbs.sum().item()/vldlbs.shape[0]
(0.4722129967895494, 0.4657534246575342)

These ratios tell us that there are slightly less than half soluble proteins in the training an validation data, and slightly more than half in the test set.

Dataset and DataLoaders

Turn train and valid data into datasets using the Dataset class.

trnds = Dataset(trntns, trnlbs)
vldds = Dataset(vldtns, vldlbs)
trnds[0]
(tensor([11,  9,  1, 10,  2, 10, 10, 10, 10, 13, 18, 10,  6, 10, 10, 18, 16, 16,  9, 17, 10,  2, 16, 11,  4,  4,  1,  8, 12,  4, 15,  8, 14,
          4, 18,  1,  6, 16, 10,  8,  5, 15,  1,  8, 16, 16,  8,  6, 10,  4,  2, 14, 16, 18, 17, 16, 15,  6,  3, 10,  1, 17,  2, 13, 15,  6,
          5,  1, 18, 17,  6,  2, 17,  2,  6, 16,  1,  2,  6, 16, 19,  3, 18, 15,  1,  4, 17, 17,  2,  7,  2, 14,  2,  1,  6, 11,  3, 19, 17,
          6,  1, 15,  2,  2, 15, 18, 14, 13, 10,  4,  7,  7,  7,  7,  7,  7,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,
          0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,
          0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,
          0,  0]),
 tensor(0.))

Use the get_dls function to obtain the dataloaders from the train and valid datasets.

dls = get_dls(trnds, vldds, bs=32)
next(iter(dls.train))[0][:2], next(iter(dls.train))[1][:2]
(tensor([[10, 15, 16, 18,  5, 18, 16,  6,  5, 13, 15,  6, 18,  3, 16,  1, 14, 10, 16,  4, 20,  5, 10,  1,  5,  6, 13, 18,  1, 16, 18, 18, 11,
           3,  9,  3,  9,  6, 18,  5,  1,  8, 18,  4, 11,  6,  3, 18,  6,  1, 15,  4,  1, 18, 10, 16, 14, 16, 14,  7, 16, 10,  6,  6,  7, 15,
          10, 15, 18, 15, 13, 15,  4, 14,  9,  4,  5, 14, 16, 13,  1, 16,  9, 16, 13,  9,  6,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,
           0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,
           0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,
           0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,
           0,  0],
         [11, 12, 13, 16,  1, 13, 16, 20, 13, 11,  1, 16, 10, 20, 18,  6,  3, 10,  7, 13,  3, 18, 17,  4,  1, 11, 10, 20,  4,  9,  5, 16, 13,
           1,  6, 13,  8, 10, 16,  8, 15, 18,  2, 15,  3, 11,  8, 17, 15, 15, 16, 10,  6, 20,  1, 20, 18, 12,  5, 14, 14, 13,  1,  3,  1,  4,
          15,  1, 10,  3, 17, 11, 12,  5,  3, 18,  8,  9,  6,  9, 13, 18, 15,  8, 11, 19, 16, 14, 15,  3, 13, 16, 10, 15,  9, 16,  6, 18,  6,
          12,  8,  5,  8,  9, 12, 10,  3,  9, 16,  8,  3, 12,  9,  1, 10, 20,  3, 17,  5, 16,  1,  5,  6, 12,  8, 10, 16,  2,  9, 18, 18,  2,
           3,  4, 12,  6, 16,  9,  6, 20,  6,  5, 18,  7,  5,  4, 17, 14,  4,  1,  1,  4, 15,  1,  8,  4,  9, 11, 12,  6, 11, 10, 10, 12,  3,
          15,  9, 18,  5, 18,  6, 15,  5,  9, 16, 15,  9,  4, 15,  4,  1,  4, 10,  6,  1, 15,  1,  9,  4,  5,  0,  0,  0,  0,  0,  0,  0,  0,
           0,  0]]),
 tensor([1., 1.]))

Design Your Model

Let’s create a tiny model (~10k parameters) that uses a sequence of 1-dimensional convolutional layers with skip connections, kaiming he initialization, leaky relus, batchnorm, and dropout.

First, obtain a single batch from dls to help design the model.

idx = next(iter(dls.train))[0] ## a single batch
idx, idx.shape
(tensor([[11,  9,  9,  ...,  0,  0,  0],
         [11,  3, 20,  ...,  0,  0,  0],
         [ 1,  5,  4,  ...,  0,  0,  0],
         ...,
         [ 1, 18, 18,  ...,  0,  0,  0],
         [10,  6,  5,  ...,  0,  0,  0],
         [ 2,  8,  1,  ...,  0,  0,  0]]),
 torch.Size([32, 200]))

Custom Modules

def conv1d(ni, nf, ks=3, stride=2, act=nn.ReLU, norm=None, bias=None):
    if bias is None: bias = not isinstance(norm, (nn.BatchNorm1d,nn.BatchNorm2d,nn.BatchNorm3d))
    layers = [nn.Conv1d(ni, nf, stride=stride, kernel_size=ks, padding=ks//2, bias=bias)]
    if norm: layers.append(norm(nf))
    if act: layers.append(act())
    return nn.Sequential(*layers)

def _conv1d_block(ni, nf, stride, act=nn.ReLU, norm=None, ks=3):
    return nn.Sequential(conv1d(ni, nf, stride=1, act=act, norm=norm, ks=ks),
                         conv1d(nf, nf, stride=stride, act=None, norm=norm, ks=ks))

class ResBlock1d(nn.Module):
    def __init__(self, ni, nf, stride=1, ks=3, act=nn.ReLU, norm=None):
        super().__init__()
        self.convs = _conv1d_block(ni, nf, stride=stride, ks=ks, act=act, norm=norm)
        self.idconv = fc.noop if ni==nf else conv1d(ni, nf, stride=1, ks=1, act=None)
        self.pool = fc.noop if stride==1 else nn.AvgPool1d(stride, ceil_mode=True)
        self.act = act()

    def forward(self, x): return self.act(self.convs(x) + self.pool(self.idconv(x)))

The following module switches the rank order from BLC to BCL.

class Reshape(nn.Module):
    def forward(self, x): 
        B, L, C = x.shape
        return x.view(B, C, L)

Model Architecture

lr = 1e-2
epochs = 30
n_embd = 16
dls = get_dls(trnds, vldds, bs=32)
act_genrelu = partial(GeneralRelu, leak=0.1, sub=0.4)

model = nn.Sequential(nn.Embedding(vocab_size, n_embd, padding_idx=0), Reshape(),
                      ResBlock1d(n_embd, 2, ks=15, stride=2, norm=nn.BatchNorm1d, act=act_genrelu), nn.Dropout(0.1),
                      ResBlock1d(2, 4, ks=13, stride=2, norm=nn.BatchNorm1d, act=act_genrelu), nn.Dropout(0.1),
                      ResBlock1d(4, 4, ks=11, stride=2, norm=nn.BatchNorm1d, act=act_genrelu), nn.Dropout(0.1),
                      ResBlock1d(4, 4, ks=9, stride=2, norm=nn.BatchNorm1d, act=act_genrelu), nn.Dropout(0.1),
                      ResBlock1d(4, 8, ks=7, stride=2, norm=nn.BatchNorm1d, act=act_genrelu), nn.Dropout(0.1),
                      ResBlock1d(8, 8, ks=5, stride=2, norm=nn.BatchNorm1d, act=act_genrelu), nn.Dropout(0.1),
                      ResBlock1d(8, 16, ks=3, stride=2, norm=nn.BatchNorm1d, act=act_genrelu), nn.Dropout(0.1),
                      ResBlock1d(16, 32, ks=3, stride=2, norm=nn.BatchNorm1d, act=act_genrelu), nn.Dropout(0.1),
                      nn.Flatten(1, -1),
                      nn.Linear(32, 1),
                      nn.Flatten(0, -1),
                      nn.Sigmoid())
model(idx).shape
torch.Size([32])
iw = partial(init_weights, leaky=0.1)
model = model.apply(iw)
metrics = MetricsCB(BinaryAccuracy(), BinaryMatthewsCorrCoef(), BinaryAUROC())
astats = ActivationStats(fc.risinstance(GeneralRelu))
cbs = [DeviceCB(), ProgressCB(plot=False), metrics, astats]
learn = TrainLearner(model, dls, F.binary_cross_entropy, lr=lr, cbs=cbs, opt_func=torch.optim.AdamW)
print(f"Parameters total: {sum(p.nelement() for p in model.parameters())}")
learn.lr_find(start_lr=1e-4, gamma=1.05, av_over=3, max_mult=5)
Parameters total: 10175
<style> /* Turns off some styling */ progress { /* gets rid of default border in Firefox and Opera. */ border: none; /* Needs to be in here for Safari polyfill so background images work as expected. */ background-size: auto; } progress:not([value]), progress:not([value])::-webkit-progress-bar { background: repeating-linear-gradient(45deg, #7e7e7e, #7e7e7e 10px, #5c5c5c 10px, #5c5c5c 20px); } .progress-bar-interrupted, .progress-bar-interrupted::-webkit-progress-bar { background: #F44336; } </style>
<div>
  <progress value='0' class='' max='10' style='width:300px; height:20px; vertical-align: middle;'></progress>
  0.00% [0/10 00:00&lt;?]
</div>
&#10;

87.08% [492/565 00:33<00:04 2.113]

This is a pretty noisy training set, so the learning rate finder does not work very well. Yet it is possible to get a somewhat informative result using the av_over keyword argument that tells lr_find to average over the specified number of batches for each learning rate tested. It also helps to dial the gamma value down from its default value of 1.3.

Training

learn.fit(epochs)
<style> /* Turns off some styling */ progress { /* gets rid of default border in Firefox and Opera. */ border: none; /* Needs to be in here for Safari polyfill so background images work as expected. */ background-size: auto; } progress:not([value]), progress:not([value])::-webkit-progress-bar { background: repeating-linear-gradient(45deg, #7e7e7e, #7e7e7e 10px, #5c5c5c 10px, #5c5c5c 20px); } .progress-bar-interrupted, .progress-bar-interrupted::-webkit-progress-bar { background: #F44336; } </style>
BinaryAccuracy BinaryMatthewsCorrCoef BinaryAUROC loss epoch train
0.507 0.001 0.504 0.718 0 train
0.534 -0.021 0.514 0.691 0 eval
0.515 0.008 0.506 0.697 1 train
0.539 0.040 0.530 0.691 1 eval
0.519 0.015 0.509 0.695 2 train
0.534 0.003 0.498 0.691 2 eval
0.519 0.017 0.517 0.694 3 train
0.525 0.036 0.527 0.692 3 eval
0.582 0.155 0.592 0.675 4 train
0.638 0.283 0.649 0.633 4 eval
0.618 0.242 0.629 0.652 5 train
0.651 0.321 0.666 0.619 5 eval
0.627 0.266 0.630 0.647 6 train
0.656 0.329 0.664 0.618 6 eval
0.635 0.286 0.637 0.641 7 train
0.647 0.332 0.679 0.623 7 eval
0.636 0.284 0.648 0.637 8 train
0.645 0.309 0.680 0.614 8 eval
0.635 0.281 0.647 0.636 9 train
0.649 0.346 0.682 0.627 9 eval
0.636 0.286 0.656 0.632 10 train
0.654 0.340 0.684 0.613 10 eval
0.646 0.304 0.666 0.627 11 train
0.653 0.314 0.686 0.614 11 eval
0.645 0.299 0.665 0.627 12 train
0.666 0.327 0.702 0.605 12 eval
0.648 0.301 0.676 0.622 13 train
0.665 0.340 0.704 0.600 13 eval
0.657 0.319 0.684 0.619 14 train
0.670 0.333 0.717 0.609 14 eval
0.656 0.318 0.688 0.616 15 train
0.655 0.313 0.703 0.619 15 eval
0.652 0.308 0.682 0.619 16 train
0.674 0.352 0.719 0.597 16 eval
0.659 0.324 0.692 0.614 17 train
0.662 0.348 0.717 0.606 17 eval
0.658 0.320 0.693 0.613 18 train
0.668 0.336 0.718 0.604 18 eval
0.657 0.316 0.698 0.612 19 train
0.662 0.339 0.715 0.602 19 eval
0.660 0.325 0.697 0.612 20 train
0.662 0.330 0.716 0.607 20 eval
0.665 0.334 0.700 0.611 21 train
0.662 0.317 0.703 0.609 21 eval
0.665 0.337 0.698 0.609 22 train
0.666 0.326 0.712 0.607 22 eval
0.666 0.336 0.703 0.608 23 train
0.677 0.360 0.723 0.591 23 eval
0.663 0.330 0.703 0.608 24 train
0.676 0.358 0.722 0.595 24 eval
0.666 0.335 0.708 0.607 25 train
0.675 0.361 0.723 0.594 25 eval
0.661 0.323 0.707 0.608 26 train
0.664 0.321 0.708 0.615 26 eval
0.664 0.328 0.710 0.605 27 train
0.663 0.322 0.723 0.602 27 eval
0.669 0.337 0.711 0.606 28 train
0.647 0.290 0.701 0.619 28 eval
0.669 0.339 0.715 0.602 29 train
0.665 0.336 0.719 0.605 29 eval

Inspect Activations

dls = get_dls(trnds, vldds, bs=256)

model = nn.Sequential(nn.Embedding(vocab_size, n_embd, padding_idx=0), Reshape(),
                      ResBlock1d(n_embd, 2, ks=15, stride=2, norm=nn.BatchNorm1d, act=act_genrelu), nn.Dropout(0.1),
                      ResBlock1d(2, 4, ks=13, stride=2, norm=nn.BatchNorm1d, act=act_genrelu), nn.Dropout(0.1),
                      ResBlock1d(4, 4, ks=11, stride=2, norm=nn.BatchNorm1d, act=act_genrelu), nn.Dropout(0.1),
                      ResBlock1d(4, 4, ks=9, stride=2, norm=nn.BatchNorm1d, act=act_genrelu), nn.Dropout(0.1),
                      ResBlock1d(4, 8, ks=7, stride=2, norm=nn.BatchNorm1d, act=act_genrelu), nn.Dropout(0.1),
                      ResBlock1d(8, 8, ks=5, stride=2, norm=nn.BatchNorm1d, act=act_genrelu), nn.Dropout(0.1),
                      ResBlock1d(8, 16, ks=3, stride=2, norm=nn.BatchNorm1d, act=act_genrelu), nn.Dropout(0.1),
                      ResBlock1d(16, 32, ks=3, stride=2, norm=nn.BatchNorm1d, act=act_genrelu), nn.Dropout(0.1),
                      nn.Flatten(1, -1),
                      nn.Linear(32, 1),
                      nn.Flatten(0, -1),
                      nn.Sigmoid())

model = model.apply(iw)
metrics = MetricsCB(BinaryAccuracy(), BinaryMatthewsCorrCoef(), BinaryAUROC())
astats = ActivationStats(fc.risinstance(GeneralRelu))
cbs = [DeviceCB(), ProgressCB(plot=False), metrics, astats]
learn = TrainLearner(model, dls, F.binary_cross_entropy, lr=lr, cbs=cbs, opt_func=torch.optim.AdamW)
print(f"Parameters total: {sum(p.nelement() for p in model.parameters())}")
learn.fit(1)
Parameters total: 10175
<style> /* Turns off some styling */ progress { /* gets rid of default border in Firefox and Opera. */ border: none; /* Needs to be in here for Safari polyfill so background images work as expected. */ background-size: auto; } progress:not([value]), progress:not([value])::-webkit-progress-bar { background: repeating-linear-gradient(45deg, #7e7e7e, #7e7e7e 10px, #5c5c5c 10px, #5c5c5c 20px); } .progress-bar-interrupted, .progress-bar-interrupted::-webkit-progress-bar { background: #F44336; } </style>
BinaryAccuracy BinaryMatthewsCorrCoef BinaryAUROC loss epoch train
0.507 -0.002 0.498 0.713 0 train
0.524 0.010 0.524 0.691 0 eval
astats.color_dim()

astats.plot_stats()

astats.dead_chart()

Project details


Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

atai-0.0.2.tar.gz (26.8 kB view hashes)

Uploaded Source

Built Distribution

atai-0.0.2-py3-none-any.whl (19.2 kB view hashes)

Uploaded Python 3

Supported by

AWS AWS Cloud computing and Security Sponsor Datadog Datadog Monitoring Fastly Fastly CDN Google Google Download Analytics Microsoft Microsoft PSF Sponsor Pingdom Pingdom Monitoring Sentry Sentry Error logging StatusPage StatusPage Status page