Antigen Receptor Classifier
Project description
ARC (Antigen Receptor Classifier)
Authors: Austin Crinklaw, Swapnil Mahajan
Requirements:
- Linux OS
- HMMER3
- NCBI Blast+
- Python 3+
- Python packages: Pandas, BioPython
Installation:
We provide a Dockerfile for ease of use.
ARC can also be downloaded through PyPI using the following pip command.
pip install bio-arc
Testing Installation:
A quick check for proper dependencies and successful installation can be performed by navigating to your pip package install directory (which can be located by executing pip show bio-arc
) and running the following command:
python3 -m arc_test
Passing all unit-tests means that your system is configured properly and ready to classify some protein sequences.
Usage:
Input
- A fasta format file with one or more protein sequences.
>1WBZ_A_alpha I H2-Kb
MVPCTLLLLLAAALAPTQTRAGPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPPSTVSNMATVAVLVVLGAAIVTGAVVAFVMKMRRRNTGGKGGDYALAPGSQTSDLSLPDCKVMVHDPHSLA
>1WBZ_B_b2m I H2-Kb
MARSVTLVFLVLVSLTGLYAIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHASMAEPKTVYWDRDM
Commands
- Using Fasta file as an input:
python -m ARC classify -i /path/to/input.fasta -o /path/to/output.csv
Output
- Output file has 4 columns in CSV format.
- First column named 'ID' is the description provoded in the fasta for each sequence.
- Second column named 'class' is the assigned molecule class for each sequence.
- e.g. MHC-I, MHC-II, BCR or TCR.
- The third column named 'chain_type' is the assigned chain type for each sequence.
- e.g. alpha, beta, heavy, lambda, kappa, scFv, TscFv or construct. These will also be labelled as V for variable domain or C for constant domain.
- The fourth column named 'calc_mhc_allele' is the MHC allele identified using groove domain similarity to MRO alleles.
ID | class | chain_type | calc_mhc_allele |
---|---|---|---|
1WBY_A_alpha I H2-Db | MHC-I | alpha V | |
1WBY_B_b2m I H2-Db | |||
1HQR_A_alpha II HLA-DRA01:01/DRB501:01 | MHC-II | alpha C | HLA-DRA*01:01 |
1HQR_B_beta II HLA-DRA01:01/DRB501:01 | MHC-II | beta C | HLA-DRB5*01:01 |
2CMR_H_heavy | BCR | heavy V | |
2CMR_L_light | BCR | kappa C | |
4RFO_L_light | BCR | lambda V | |
3UZE_A_heavy | BCR | scFv | |
1FYT_D_alpha | TCR | alpha V | |
1FYT_E_beta | TCR | beta C | |
3TF7_C_alpha | TCR | TscFv |
How it works:
- BCR and TCR chains are identified using HMMs. A given protein sequence is searched against HMMs built using BCR and TCR chain sequences from IMGT. HMMER is used to align an input sequence to the HMMs.
- MHC class I (alpha1-alpha2 domains) and MHC class I alpha and beta chain HMMs are downloaded from Pfam website. An input protein sequence is searched against these HMMs. A HMMER bit score threshold of 25 was used to identify MHC chain sequences.
- To identify MHC alleles, groove domains (G-domains) are assigned based on the MRO repository.
- IgNAR sequences are identified through querying against a custom blast database.
References:
Several methods for HMMER result parsing were sourced from ANARCI.
Project details
Release history Release notifications | RSS feed
Download files
Download the file for your platform. If you're not sure which to choose, learn more about installing packages.
Source Distribution
bio-arc-0.0.17.tar.gz
(15.2 MB
view hashes)
Built Distribution
bio_arc-0.0.17-py2-none-any.whl
(19.2 MB
view hashes)