bio-shark 1.2.1

SHARK (Similarity/Homology Assessment by Relating K-mers)

SHARK (Similarity/Homology Assessment by Relating K-mers)

To accurately assess homology between unalignable sequences, we developed an alignment-free sequence comparison algorithm, SHARK (Similarity/Homology Assessment by Relating K-mers).

SHARK-dive

We trained SHARK-dive, a machine learning homology classifier, which achieved superior performance to standard alignment in assessing homology in unalignable sequences, and correctly identified dissimilar IDRs capable of functional rescue in IDR-replacement experiments reported in the literature.

1. Dive-Score

Scoring the similarity between a pair of sequence

Variants:

1. Normal (SHARK-score (T))
2. Sparse (SHARK-score (best))

2. Dive-Predict

Find sequences similar to a given query from a target set

User Section

Installation

SHARK officially supports Python versions >=3.9,<3.12.

Recommended Use within a local python virtual environment

python3 -m venv /path/to/new/virtual/environment

SHARK is installable from PyPI soon

$ pip install bio-shark

SHARK is also installable from source

• This allows users to import functionalities as a python package
• This also allows user to run the functionalities as a command line utility

$ git clone [e-mail]:tothpetroczylab/shark.git

Once you have a copy of the source, you can embed it in your own Python package, or install it into your site-packages easily.

# Make sure you have the required Python version installed
$ python3 --version
Python 3.11.5

$ cd shark
$ python3 -m venv shark-env
$ source shark-env/bin/activate
$ (shark-env) % python -m pip install .

SHARK is also installable from GitLab source directly

$ pip install git+https://git.mpi-cbg.de/tothpetroczylab/shark.git

How to use?

1. Dive

1.1. Scoring: Given two protein sequences and a k-mer length (1 to 20), score the similarity b/w them

Inputs

1. Protein Sequence 1
2. Protein Sequence 2
3. Scoring-variant: Normal (SHARK-score (T))/ Sparse (SHARK-score (best))
   1. Threshold (for "Normal")
4. K-Mer Length (Should be <= smallest_len(sequences))

1.1.1. As a command-line utility

• Run the command shark-score
• Enter sequences when command prompts
• Enter the variant (1/2) when the command prompts

% shark-score 
Enter Sequence 1:
> SSSSPINTHGVSTTVPSSNNTIIPSSDGVSLSQTDYFDTVHNRQSPSRRESPVTVFRQPSLSHSKSLHKDSKNKVPQISTNQSHPSAVSTANTPGPSPN
Enter Sequence 2:
> VAEREFNGRSNSLHANFTSPVPRTVLDHHRHELTFCNPNNTTGFKTITPSPPTQHQSILPTAVDNVPRSKSVSSLPVSGFPPLIVKQQQQQQLNSSSSASALPSIHSPLTNEH
Enter k-mer length (integer 1 - 10): > 5
Press: 1. Normal; 2. Sparse
> 1
Enter threshold:
>0.8
Similarity Score: 0.6552442773

1.1.2. As an imported python package

from bio_shark.core import utils
from bio_shark.dive.run import run_normal, run_sparse

dive_t_score = run_normal(
    sequence1="LASIDPTFKAN",
    sequence2="ERQKNGGKSDSDDDEPAAKKKVEYPIAAAPPMMMP",
    k=3,
    threshold=0.8
)   # Compute SHARK-score (T)  

dive_best_score = run_sparse(
    sequence1="LASIDPTFKAN",
    sequence2="ERQKNGGKSDSDDDEPAAKKKVEYPIAAAPPMMMP",
    k=3,
)   # Compute SHARK-score (best)

1.2. Similarity Prediction

1.2.1. As an imported python package

from bio_shark.dive.prediction import Prediction

predictor = Prediction(q_sequence_id_map=<dict-fasta-id-seq>, t_sequence_id_map=<dict-fasta-id-seq>)

expected_out_keys = ['seq_id1', 'sequence1', 'seq_id2', 'sequence2', 'similarity_scores_k', 'pred_label', 'pred_proba']
output = predictor.predict()    # List of output objects; Each element is for one pair

1.2.2. As a command-line utility

• Run the command shark-dive with the absolute path of the sequence fasta files as only argument
• Sequences should be of length > 10, since prediction is always based on scores of k = [1..10]
• You may use the sample_fasta_file.fasta from data folder (Owncloud link)

usage: shark-dive [-h] [--output_dir OUTPUT_DIR] query target

DIVE-Predict: Given some query sequences, compute their similarity from the list of target sequences;Target is
supposed to be major database of protein sequences

positional arguments:
  query       Absolute path to fasta file for the query set of input sequences
  target      Absolute path to fasta file for the target set of input sequences

options:
  -h, --help  show this help message and exit
  --output_dir OUTPUT_DIR
                        Output folder (default: current working directory)
  
$ shark-dive "<query-fasta-file>.fasta" "<target-fasta-file>.fasta"
Read fasta file from path <query-fasta-file>.fasta; Found 4 sequences; Skipped 0 sequences for having X
Read fasta file from path <target-fasta-file>.fasta; Found 6 sequences; Skipped 0 sequences for having X
Output stored at <OUTPUT_DIR>/<path-to-sequence-fasta-file>.fasta.csv

• Output CSV has the following column headers:
  • (1) "Query": Fasta ID of sequence from Query list
  • (2) "Target": Fasta ID of sequence from Target list
  • (3..12) "SHARK-Score (k=*)": Similarity score between the two sequences for specific k-value
  • (13) "SHARK-Dive": Aggregated similarity score over all lengths of k-mer

Publication

SHARK enables homology assessment in unalignable and disordered sequences

Chi Fung Willis Chow, Soumyadeep Ghosh, Anna Hadarovich, Agnes Toth-Petroczy*

Accepted

Biorxiv link: https://www.biorxiv.org/content/10.1101/2023.06.26.546490v1

This work is licensed under a Creative Commons Attribution-ShareAlike 4.0 International License.