Skip to main content

Wrapper on top of ESM/Protbert model in order to easily work with protein embedding

Project description

Description

bio-transformers is a wrapper on top of the ESM/Protbert model, trained on millions on proteins and used to predict embeddings. This package provide other functionalities (like compute the loglikelihood of a protein) or compute embeddings on multiple-gpu.

Installation

It is recommended to work with conda environnements in order to manage the specific dependencies of the package.

  conda create --name bio-transformers python=3.7 -y 
  conda activate bio-transformers
  pip install bio-transformers

How it works

The main class BioTranformers allow the developper to use Protbert and ESM backend

from biotransformers import BioTransformers
BioTransformers.list_backend()

Embeddings

Choose a backend and pass a list of sequences of Amino acids to compute the embeddings. By default, the compute_embeddings function return the <CLS> token embedding. You can add a pooling_list in addition , so you can compute the mean of the tokens embeddings.

from biotransformers import BioTransformers

sequences = [
        "MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG",
        "KALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLQEE",
    ]

bio_trans = BioTransformers(model_dir="Rostlab/prot_bert")
embeddings = bio_trans.compute_embeddings(sequences, pooling_list=['mean'])

cls_emb = embeddings['cls']
mean_emb = embeddings['mean']

Loglikelihood

Choose a backend and pass a list of sequences of Amino acids to compute the Loglikelihood.

from biotransformers import BioTransformers

sequences = [
        "MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG",
        "KALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLQEE",
    ]

bio_trans = BioTransformers(model_dir="Rostlab/prot_bert")
loglikelihood = bio_trans.compute_loglikelihood(sequences)

Project details


Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

bio-transformers-0.0.2.tar.gz (11.4 kB view hashes)

Uploaded Source

Built Distribution

bio_transformers-0.0.2-py3-none-any.whl (18.8 kB view hashes)

Uploaded Python 3

Supported by

AWS AWS Cloud computing and Security Sponsor Datadog Datadog Monitoring Fastly Fastly CDN Google Google Download Analytics Microsoft Microsoft PSF Sponsor Pingdom Pingdom Monitoring Sentry Sentry Error logging StatusPage StatusPage Status page