Wrapper on top of ESM/Protbert model in order to easily work with protein embedding
Project description
Table of contents
Bio-transformers
bio-transformers
is a python wrapper on top of the ESM/Protbert models, which are Transformers protein language models, trained on millions of proteins and used to predict embeddings.
This package provides a unified interface to use all these models - which we call backends
. For instance you'll be able to compute natural amino-acids probabilities ,embeddings or easily finetune your model on multiple-GPUs.
You can find the original repositories for the models here :
Installation
It is recommended to work with conda environments in order to manage the specific dependencies of this package.
conda create --name bio-transformers python=3.7 -y
conda activate bio-transformers
pip install bio-transformers
Usage
Quick start
The main class BioTranformers
allows developers to use Protbert and ESM backends
> from biotransformers import BioTransformers
> BioTransformers.list_backend()
Use backend in this list :
* esm1_t34_670M_UR100
* esm1_t6_43M_UR50S
* esm1b_t33_650M_UR50S
* esm_msa1_t12_100M_UR50S
* protbert
* protbert_bfd
Embeddings
Choose a backend and pass a list of sequences of Amino acids to compute the embeddings.
By default, the compute_embeddings
function returns the <CLS>
token embeddings.
You can add a pool_mode
in addition, so you can compute the mean of the tokens embeddings.
from biotransformers import BioTransformers
sequences = [
"MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG",
"KALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLQEE",
]
bio_trans = BioTransformers(backend="protbert")
embeddings = bio_trans.compute_embeddings(sequences, pool_mode=('cls','mean'))
cls_emb = embeddings['cls']
mean_emb = embeddings['mean']
Multi-gpu
If you have access to multiple GPUs, you can activate the multi_gpu
option to speed-up the inference.
This option relies on torch.nn.DataParallel
.
bio_trans = BioTransformers(backend="protbert",multi_gpu=True)
embeddings = bio_trans.compute_embeddings(sequences, pool_mode=('cls','mean'))
Pseudo-Loglikelihood
The protein loglikelihood is a metric that estimates the joint probability of observing a given sequence of amino acids. The idea behind such an estimator is to approximate the probability that a mutated protein will be “natural”, and can effectively be produced by a cell.
These metrics rely on transformers language models. These models are trained to predict a “masked” amino acid in a sequence. As a consequence, they can provide us with an estimate of the probability of observing an amino acid given the “context” (the surrounding amino acids). By multiplying individual probabilities computed for a given amino-acid given its context, we obtain a pseudo-likelihood, which can be a candidate estimator to approximate sequence stability.
from biotransformers import BioTransformers
sequences = [
"MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG",
"KALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLQEE",
]
bio_trans = BioTransformers(backend="protbert",device="cuda:0")
loglikelihood = bio_trans.compute_loglikelihood(sequences)
Finetune pre-trained transformers on your dataset
You can use the train_masked
function to finetune your backend on your dataset. The model is automatically scaled on the available GPUs. More information on the documentation
import biodatasets
import numpy as np
from biotransformers import BioTransformers
data = biodatasets.load_dataset("swissProt")
X, y = data.to_npy_arrays(input_names=["sequence"])
X = X[0]
# Train on small sequences
length = np.array(list(map(len, X))) < 200
train_seq = X[length][:15000]
bio_trans = BioTransformers("esm1_t6_43M_UR50S", device="cuda")
bio_trans.train_masked(
train_seq,
lr=1.0e-5,
warmup_init_lr=1e-7,
toks_per_batch=2000,
epochs=20,
batch_size=16,
acc_batch_size=256,
warmup_updates=1024,
accelerator="ddp",
checkpoint=None,
save_last_checkpoint=False,
)
Roadmap:
- support MSA transformers
Citations
Here some papers on interest on the subject.
The excellent ProtBert work can be found at (biorxiv preprint):
@article{protTrans2021,
author={Ahmed Elnaggar and Michael Heinzinger, Christian Dallago1,Ghalia Rihawi, Yu Wang, Llion Jones, Tom Gibbs, Tamas Feher, Christoph Angerer,Debsindhu Bhowmik and Burkhard Rost},
title={ProtTrans: Towards Cracking the Language of Life’s Code Through Self-Supervised Deep Learning and High Performance Computing},
year={2019},
doi={10.1101/2020.07.12.199554},
url={https://www.biorxiv.org/content/10.1101/2020.07.12.199554v3.full.pdf},
journal={bioRxiv}
}
For the ESM model, see (biorxiv preprint):
@article{rives2019biological,
author={Rives, Alexander and Meier, Joshua and Sercu, Tom and Goyal, Siddharth and Lin, Zeming and Liu, Jason and Guo, Demi and Ott, Myle and Zitnick, C. Lawrence and Ma, Jerry and Fergus, Rob},
title={Biological Structure and Function Emerge from Scaling Unsupervised Learning to 250 Million Protein Sequences},
year={2019},
doi={10.1101/622803},
url={https://www.biorxiv.org/content/10.1101/622803v4},
journal={bioRxiv}
}
For the self-attention contact prediction, see the following paper (biorxiv preprint):
@article{rao2020transformer,
author = {Rao, Roshan M and Meier, Joshua and Sercu, Tom and Ovchinnikov, Sergey and Rives, Alexander},
title={Transformer protein language models are unsupervised structure learners},
year={2020},
doi={10.1101/2020.12.15.422761},
url={https://www.biorxiv.org/content/10.1101/2020.12.15.422761v1},
journal={bioRxiv}
}
For the MSA Transformer, see the following paper (biorxiv preprint):
@article{rao2021msa,
author = {Rao, Roshan and Liu, Jason and Verkuil, Robert and Meier, Joshua and Canny, John F. and Abbeel, Pieter and Sercu, Tom and Rives, Alexander},
title={MSA Transformer},
year={2021},
doi={10.1101/2021.02.12.430858},
url={https://www.biorxiv.org/content/10.1101/2021.02.12.430858v1},
journal={bioRxiv}
}
License
This source code is licensed under the Apache 2 license found in the LICENSE
file in the root directory.
Project details
Release history Release notifications | RSS feed
Download files
Download the file for your platform. If you're not sure which to choose, learn more about installing packages.
Source Distribution
Built Distribution
File details
Details for the file bio-transformers-0.0.8.tar.gz
.
File metadata
- Download URL: bio-transformers-0.0.8.tar.gz
- Upload date:
- Size: 24.1 kB
- Tags: Source
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/3.4.1 importlib_metadata/4.4.0 pkginfo/1.7.0 requests/2.25.1 requests-toolbelt/0.9.1 tqdm/4.61.0 CPython/3.7.10
File hashes
Algorithm | Hash digest | |
---|---|---|
SHA256 | 3e969d147f3289c66ee0671a9bd182468b74c8e11e81832f5c375996deff7d57 |
|
MD5 | bf7d6b22b7490c8e5843ad099d66a610 |
|
BLAKE2b-256 | 6d31b6250922b0e8d4912f39fa2c7413dfdeb6dbd628698f409c418ff9a41aa2 |
File details
Details for the file bio_transformers-0.0.8-py3-none-any.whl
.
File metadata
- Download URL: bio_transformers-0.0.8-py3-none-any.whl
- Upload date:
- Size: 36.0 kB
- Tags: Python 3
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/3.4.1 importlib_metadata/4.4.0 pkginfo/1.7.0 requests/2.25.1 requests-toolbelt/0.9.1 tqdm/4.61.0 CPython/3.7.10
File hashes
Algorithm | Hash digest | |
---|---|---|
SHA256 | 357d05a678d3845970021a90719c7ccac776a1e635a9701bb7bf202fe22814df |
|
MD5 | 89956de808121fd129c1d07b2e52298c |
|
BLAKE2b-256 | d3cd3767203eef086ae33fbb6631ab487ad5ae06e7756edb4ff827424681913a |