No project description provided
Project description
Docko
Docking for ligands a discusting mix of code combining the latest from Chai with old scool bro vina.
Made this for myself but others wanted to use. Love only pls. Take it as it is <3 but if you notice bugs, please submit an issue, be a g.
Install
Make sure you have vina installed: https://autodock-vina.readthedocs.io/en/latest/installation.html
I have not found it to work with pip needs the executable.
Works on mac and liunx, you need big power tho for Chai so would rec linux.
Note you need openmm==8.0 (if you get some random modeller error this should fix it, it arrises from an incompatibility with openmm and pdbfixer gah)
conda create --name docko python=3.10 -y
conda activate docko
conda install -c conda-forge pdbfixer -y
pip install openmm==8.0
conda config --env --add channels conda-forge
pip install git+https://github.com/chaidiscovery/chai-lab.git
install docko now
conda activate docko
pip install docko
Maybe if you're feeling wild install boltz
pip install boltz
Lucky last since vina is a b
You need to make a second environment just to prepare the ligand, I came across this issue when making all my stuff.
conda create --name vina python=3.9.7 -y
conda activate vina
conda install -c conda-forge numpy openbabel pdbfixer scipy rdkit -y
pip install meeko
Quick start
Use case 1: you have a sequence and you want to bind it
Here you're best bet is using Chai, this will automatically handle everything for you:
Example:
from docko import *
base_dir = 'some_folder' # A folder on your computer
run_chai('A0A0E3LLD2_METBA', # name
'MSIEKIPGYTYGKTESMSPLNLEDLKLLKDSVMFTEEDEKYLKKAGEVLEDQVEEILDTWYGFVGSHPHLLYYFTSPDGTPNEEYLAAVRKRFSKWILDTCNRNYDQAWLDYQYEIGLRHHRTKKNRTDNVESVPNINYRYLVAFIYPITATIKPFLARKGHTSEEVEKMHQAWFKATVLQVALWSYPYVKQGDF', # sequence
'CCCCC(CC)COC(=O)C1=CC=CC=C1C(=O)OCC(CC)CCCC', # ligand as smiles
base_dir
)
The outputs will now be in base_dir.
Say you have a csv of these and you want to make bound structures for all of them:
run_chai_df(output_dir, filename, entry_column='Entry', seq_column='Sequence', ligand_column='Substrate')
This runs Chai on a csv that contains your sequneces, ligands (Substartes) and the entry name (Entry)
and makes a new folder using the entry name (this would mean you ideally don't want dumb characters in there.) And puts
all these new folders in output_dir.
Running on Boltz
About the same as chai - several options if you don't want the affinity prediction run the below:
import sys
from docko.boltz import *
base_dir = '/XXXXXXX/XXXXXXX/vscode/docko/'
run_boltz('boltzproteinexample',
'MSIEKIPGYTYGKTESMSPLNLEDLKLLKDSVMFTEEDEKYLKKAGEVLEDQVEEILDTWYGFVGSHPHLLYYFTSPDGTPNEEYLAAVRKRFSKWILDTCNRNYDQAWLDYQYEIGLRHHRTKKNRTDNVESVPNINYRYLVAFIYPITATIKPFLARKGHTSEEVEKMHQAWFKATVLQVALWSYPYVKQGDF',
'CCCCC(CC)COC(=O)C1=CC=CC=C1C(=O)OCC(CC)CCCC',
base_dir
)
# now your results are in `/XXXXXXX/XXXXXXX/vscode/docko/boltzproteinexample`
This will save the results including the confidence model and the plldt.npz file.
For affinity prediction run:
import sys
from docko.boltz import *
base_dir = '/XXXXXXX/XXXXXXX/vscode/docko/'
run_boltz_affinity('boltzproteinexample',
'MSIEKIPGYTYGKTESMSPLNLEDLKLLKDSVMFTEEDEKYLKKAGEVLEDQVEEILDTWYGFVGSHPHLLYYFTSPDGTPNEEYLAAVRKRFSKWILDTCNRNYDQAWLDYQYEIGLRHHRTKKNRTDNVESVPNINYRYLVAFIYPITATIKPFLARKGHTSEEVEKMHQAWFKATVLQVALWSYPYVKQGDF',
'CCCCC(CC)COC(=O)C1=CC=CC=C1C(=O)OCC(CC)CCCC',
base_dir,
None # or a cofactor
)
# now your results are in `/XXXXXXX/XXXXXXX/vscode/docko/boltzproteinexample`
Use case 2: you have a uniprot ID and you want to get the structure and bind a ligand with vina
Here you got told "oh wow physics informed models are the best, I don't trust ML!" this will typically arise
from someone over the age of 40. Here to humour them you can also run vina, you'll need to have it installed.
The smiles is your ligand as smiles, base_dir is where you want your data to be output. Note given we are passing
the protein_name='A0A0H2V871' which is a uniprot ID it will automatically get the structure for us. If we weren't
we would need to pre-download the PDB structure, or fold it using an online server such as AF3 or Chia (you could run
Chia and then remove the ligand as well - my fave option).
from docko import *
smiles = 'CCCCC(CC)COC(=O)C1=CC=CC=C1C(=O)OCC(CC)CCCC'
base_dir = 'some_folder' # A folder on your computer
dock(sequence='',
protein_name='A0A0H2V871', # Or the name/path of the file on your computer as pdb or cif.
smiles=smiles,
ligand_name='DEHP', # name of your chemical no funny characters, the ligand will be made in a folder named this
residues=[113, 114], # Resiudes of your active site, we position the ligand within here (I find the centroid of these guys)
protein_dir=f'{base_dir}/', # Folder to save the proteins to
ligand_dir=f'{base_dir}/', # Folder to save the input ligand to
output_dir=f'{base_dir}/', # output folder with the docked ligand and config file
pH=7.4, # pH to run docking at
method='vina', # method can be vina, ad4, or diffdock
size_x=5.0, # How far in x is alowed think of this as a cloud around your residues or residue centroid
size_y=5.0,
size_z=5.0,
num_modes=9, # Dunno check vina docks using the defaut
exhaustivenes=32 ) # higher is better but slower, this is a default
# Just checks the output was logged --> this has your "energy data" about how good the docking was
os.path.isfile(f'{base_dir}A0A0H2V871-DEHP_log.txt')
e.g. if you wanted to run it on some file, just change it to your path to your downloaded PDB file e.g.:
protein_name=f'{base_dir}data/test_existing.pdb',
This will then make the name of your directory test_existing and then save the resulst in there. I guess just
again don't have funny characters in your filename.
As above, you can also run with the option ad4 it makes all these other random files, and again was something
that someone asked me to do, was seriously painful and I don't wish it on anyone else so have made it available.
Basically uses some rando forcefield that makes in some cases vina dock better. Who knows. LMK if you have an opinion.
Use case 3: you want to use diffdock and use up all the space on your computer
dock(sequence='',
protein_name='A0A0H2V871', # Or the name/path of the file on your computer as pdb or cif.
smiles=smiles,
ligand_name='DEHP', # name of your chemical no funny characters, the ligand will be made in a folder named this
residues=[113, 114], # Resiudes of your active site, we position the ligand within here (I find the centroid of these guys)
protein_dir=f'{base_dir}/', # Folder to save the proteins to
ligand_dir=f'{base_dir}/', # Folder to save the input ligand to
output_dir=f'{base_dir}/', # output folder with the docked ligand and config file
method='diffdock', # As above just change to diffdock
)
Basically exactly as above, except you need to specify the method is diffdock.
Note you need to have TRILL installed for this to work:
micromamba create -n TRILL python=3.10 ; micromamba activate TRILL
micromamba install -c pytorch -c nvidia pytorch=2.1.2 pytorch-cuda=12.1 torchdata
micromamba install -c conda-forge openbabel pdbfixer swig openmm smina fpocket vina openff-toolkit openmmforcefields setuptools=69.5.1
micromamba install -c bioconda foldseek pyrsistent
micromamba install -c "dglteam/label/cu121" dgl
micromamba install -c pyg pyg pytorch-cluster pytorch-sparse pytorch-scatter
pip install git+https://github.com/martinez-zacharya/lightdock.git@03a8bc4888c0ff8c98b7f0df4b3c671e3dbf3b1f git+https://github.com/martinez-zacharya/ECPICK.git setuptools==69.5.1
pip install trill-proteins
Other info
PDB or structure
You need to select your structure from PDB or in liu of that, use alphafold3 server (https://alphafoldserver.com/).
Alternatively, if your IDs are PDB IDs or Uniprot IDs you can just pass those and it will get teh structures for you.
If you use the alphafoldserver you'll get cif files and this works with that too!
Working with heme based files
Unfortunatley since alphafold is some new stuff and we're working with autodock vina we will need to change the files a bit.
First, if we use the AF3 docked heme, this will be automatically "cleaned" before making the pdbqt file. So we use the pipeline on the AF3 structure.
So we need to read-add it back in after also converting it manually.
To convert it manually, we copy and paste (i know lol) the heme from the original pdb file (if you don't have this, go into a program like chimeraX and convert the .cif file to a .pdb file).
Then you open up the alpha fold pdb in a text editor and copy out the heme atoms, ommitting the last one, the Fe, as vina doesn't like this one.
Then, we convert this manually by using obabel: obabel heme.pdb -o pdbqt > heme.pdbqt
Once this has been converted, we realise that vina doesn't like many of the tags. So we need to then change this so that we remove all of these. These include (but probably not limited to)
ENDBRANCH
ROOT
BRANCH
ENDROOT
Then you can run the program as per usual :D I do this automatically within the scripts but thought I would mention it inacse things fail for you (whoever you are.)
References
(1) Martinez, Z. A.; Murray, R. M.; Thomson, M. W. TRILL: Orchestrating Modular Deep-Learning Workflows for Democratized, Scalable Protein Analysis and Engineering. bioRxiv October 27, 2023, p 2023.10.24.563881. https://doi.org/10.1101/2023.10.24.563881.
(2) Eberhardt, J.; Santos-Martins, D.; Tillack, A. F.; Forli, S. AutoDock Vina 1.2.0: New Docking Methods, Expanded Force Field, and Python Bindings. J. Chem. Inf. Model. 2021, 61 (8), 3891–3898. https://doi.org/10.1021/acs.jcim.1c00203.
(3) Chai Discovery. https://www.chaidiscovery.com/blog/introducing-chai-1 (accessed 2024-09-15).
(4) Boltz:
@article{wohlwend2024boltz1,
author = {Wohlwend, Jeremy and Corso, Gabriele and Passaro, Saro and Reveiz, Mateo and Leidal, Ken and Swiderski, Wojtek and Portnoi, Tally and Chinn, Itamar and Silterra, Jacob and Jaakkola, Tommi and Barzilay, Regina},
title = {Boltz-1: Democratizing Biomolecular Interaction Modeling},
year = {2024},
doi = {10.1101/2024.11.19.624167},
journal = {bioRxiv}
}
@article{mirdita2022colabfold,
title={ColabFold: making protein folding accessible to all},
author={Mirdita, Milot and Sch{\"u}tze, Konstantin and Moriwaki, Yoshitaka and Heo, Lim and Ovchinnikov, Sergey and Steinegger, Martin},
journal={Nature methods},
year={2022},
}
THANKX
Lastly if you liked this, give it a star ****
Project details
Download files
Download the file for your platform. If you're not sure which to choose, learn more about installing packages.
Source Distribution
Built Distribution
Filter files by name, interpreter, ABI, and platform.
If you're not sure about the file name format, learn more about wheel file names.
Copy a direct link to the current filters
File details
Details for the file docko-0.1.3.tar.gz.
File metadata
- Download URL: docko-0.1.3.tar.gz
- Upload date:
- Size: 26.3 kB
- Tags: Source
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/6.1.0 CPython/3.10.14
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
035a43d533b1de81b258acae1745bdef54490eb72fcd090ad9ee7425a29101e2
|
|
| MD5 |
7fe7e13dd89b31a44c357efb3239a1ff
|
|
| BLAKE2b-256 |
c3aaf4cda0ee7d9abbf37818298198fc88a2b43197fecd7d08080aeaa0a76822
|
File details
Details for the file docko-0.1.3-py3-none-any.whl.
File metadata
- Download URL: docko-0.1.3-py3-none-any.whl
- Upload date:
- Size: 26.0 kB
- Tags: Python 3
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/6.1.0 CPython/3.10.14
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
688d82cb9b4e9e2a57d648f2f041f0f60c3b85beb75775120cda7a72f81f4966
|
|
| MD5 |
3dfd7eaced7b930a9b1448863ed160e6
|
|
| BLAKE2b-256 |
f60d1e0bf7b287b5038b9c11679d92e1a471420b76a37d40a814a8146d3ff786
|