Skip to main content

A very simple fasta file parser.

Project description

example workflow example workflow

FastaFrames

FastaFrames is a python package to convert between FASTA files and pandas DataFrames.

Usage

To install fastaframes use pip:

pip install fastaframes

Reading a FASTA file

from fastaframes import to_df

fasta_df = to_df(data='example.fasta')

Writing a FASTA file

from fastaframes import to_fasta

to_fasta(data=fasta_df, output_file='output.fasta')

Columns:

  • db: Database from which the sequence was retrieved. db is 'sp' for UniProtKB/Swiss-Prot and 'tr' for UniProtKB/TrEMBL.
  • unique_identifier: The primary accession number of the UniProtKB entry.
  • entry_name: The entry name of the UniProtKB entry.
  • protein_name: The recommended name of the UniProtKB entry as annotated in the RecName field. For UniProtKB/TrEMBL entries without a RecName field, the SubName field is used. In case of multiple SubNames, the first one is used. The 'precursor' attribute is excluded, 'Fragment' is included with the name if applicable.
  • organism_name: The scientific name of the organism of the UniProtKB entry.
  • organism_identifier: The unique identifier of the source organism, assigned by the NCBI.
  • gene_name: The first gene name of the UniProtKB entry. If there is no gene name, OrderedLocusName or ORFname, the GN field is not listed.
  • protein_existence: The numerical value describing the evidence for the existence of the protein.
  • sequence_version: The version number of the sequence.
  • protein_sequence: The protein amino acid sequence.

Example FASTA file:

>sp|A0A087X1C5|CP2D7_HUMAN Putative cytochrome P450 2D7 OS=Homo sapiens OX=9606 GN=CYP2D7 PE=5 SV=1
MGLEALVPLAMIVAIFLLLVDLMHRHQRWAARYPPGPLPLPGLGNLLHVDFQNTPYCFDQ

Will produce the following:

db unique_identifier entry_name protein_name organism_name organism_identifier gene_name protein_existence sequence_version protein_sequence
0 sp A0A087X1C5 CP2D7_HUMAN Putative cytochrome P450 2D7 Homo sapiens 9606.0 CYP2D7 5.0 1.0 MGLEALVPLAMIVAIFLLLVDLMHRHQRWAARYPPGPLPLPGLGNLLHVDFQNTPYCFDQ

Project details


Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

fastaframes-1.1.0.tar.gz (11.3 kB view details)

Uploaded Source

Built Distribution

fastaframes-1.1.0-py3-none-any.whl (8.3 kB view details)

Uploaded Python 3

File details

Details for the file fastaframes-1.1.0.tar.gz.

File metadata

  • Download URL: fastaframes-1.1.0.tar.gz
  • Upload date:
  • Size: 11.3 kB
  • Tags: Source
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/4.0.2 CPython/3.9.18

File hashes

Hashes for fastaframes-1.1.0.tar.gz
Algorithm Hash digest
SHA256 fc6abaff395db8df3cdb1c093bdc1f62f6d5fab726a56ad39bc2ff621f2d0346
MD5 951fe08f3807d4d813b0d54fb73a3f45
BLAKE2b-256 be2445abc8f786ffedbdb398913602f2edd489964020903d40dc705714bcabbf

See more details on using hashes here.

File details

Details for the file fastaframes-1.1.0-py3-none-any.whl.

File metadata

  • Download URL: fastaframes-1.1.0-py3-none-any.whl
  • Upload date:
  • Size: 8.3 kB
  • Tags: Python 3
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/4.0.2 CPython/3.9.18

File hashes

Hashes for fastaframes-1.1.0-py3-none-any.whl
Algorithm Hash digest
SHA256 b667fac873149dd2f76970abf338fc1fa6466fb5b0309bb204d18aa5c9724474
MD5 041244aeed31580e37f035ae78f3fbca
BLAKE2b-256 5e1e56be90be78fc1b3a956d5d572a1de7daa33cba0c92fa1aadba26128a66e2

See more details on using hashes here.

Supported by

AWS AWS Cloud computing and Security Sponsor Datadog Datadog Monitoring Fastly Fastly CDN Google Google Download Analytics Microsoft Microsoft PSF Sponsor Pingdom Pingdom Monitoring Sentry Sentry Error logging StatusPage StatusPage Status page