A Python FASTA file Parser and Writer.
Project description
FastaParser
A Python FASTA file Parser and Writer.
The FASTA file format is a standard text-based format for representing nucleotide and aminoacid sequences (usual file extensions include: .fasta, .fna, .ffn, .faa and .frn). FastaParser is able to parse such files and extract the biological sequences within into Python objects. It can also handle and manipulate such sequences as well as write sequences to new or existing FASTA files.
Installation
With pip
:
$ pip install fastaparser
Usage
Read FASTA files
Generate python objects from FASTA files:
>>> import fastaparser
>>> with open("fasta_file.fasta") as fasta_file:
parser = fastaparser.Reader(fasta_file)
for seq in parser:
# seq is a FastaSequence object
print('ID:', seq.id)
print('Description:', seq.description)
print('Sequence:', seq.sequence_as_string())
print()
output:
ID: sp|P04439|HLAA_HUMAN
Description: HLA class I histocompatibility antigen, A alpha chain OS=Homo sapi...
Sequence: MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRM...
ID: sp|P15822|ZEP1_HUMAN
Description: Zinc finger protein 40 OS=Homo sapiens OX=9606 GN=HIVEP1 PE=1 SV=3...
Sequence: MPRTKQIHPRNLRDKIEEAQKELNGAEVSKKEILQAGVKGTSESLKGVKRKKIVAENHLKKIPKSPLRN...
or just parse FASTA headers and sequences, which is much faster but less feature rich:
>>> import fastaparser
>>> with open("fasta_file.fasta") as fasta_file:
parser = fastaparser.Reader(fasta_file, parse_method='quick')
for seq in parser:
# seq is a namedtuple('Fasta', ['header', 'sequence'])
print('Header:', seq.header)
print('Sequence:', seq.sequence)
print()
output:
Header: >sp|P04439|HLAA_HUMAN HLA class I histocompatibility antigen, A alpha c...
Sequence: MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRM...
Header: >sp|P15822|ZEP1_HUMAN Zinc finger protein 40 OS=Homo sapiens OX=9606 GN...
Sequence: MPRTKQIHPRNLRDKIEEAQKELNGAEVSKKEILQAGVKGTSESLKGVKRKKIVAENHLKKIPKSPLRN...
Write FASTA files
Create FASTA files from FastaSequence objects:
>>> import fastaparser
>>> with open("fasta_file.fasta", 'w') as fasta_file:
writer = fastaparser.Writer(fasta_file)
fasta_sequence = fastaparser.FastaSequence(
sequence='ACTGCTGCTAGCTAGC',
id='id123',
description='test sequence'
)
writer.writefasta(fasta_sequence)
or single header and sequence strings:
>>> import fastaparser
>>> with open("fasta_file.fasta", 'w') as fasta_file:
writer = fastaparser.Writer(fasta_file)
writer.writefasta(('id123 test sequence', 'ACTGCTGCTAGCTAGC'))
Documentation
Documentation for FastaParser is available here: https://fastaparser.readthedocs.io/en/latest
History
1.1.1 (04-09-2022)
- Added support for Python 3.9 and 3.10
1.1 (13-02-2020)
- Added property setters for:
- FastaSequence.id
- FastaSequence.description
- Added property deleters for:
- FastaSequence.id
- FastaSequence.description
- FastaSequence.sequence_type
- LetterCode.letter_type
1.0 (27-01-2020)
- First release on PyPI and Anaconda Cloud
- Reader, Writer, FastaSequence and LetterCode classes
Project details
Release history Release notifications | RSS feed
Download files
Download the file for your platform. If you're not sure which to choose, learn more about installing packages.
Source Distribution
Built Distribution
File details
Details for the file fastaparser-1.1.1.tar.gz
.
File metadata
- Download URL: fastaparser-1.1.1.tar.gz
- Upload date:
- Size: 27.9 kB
- Tags: Source
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/4.0.1 CPython/3.9.13
File hashes
Algorithm | Hash digest | |
---|---|---|
SHA256 | 55adcc43285cac07a39844de2bbc5a0b9a40eb35fa99a44b62abe19917cd778e |
|
MD5 | b5f0241695e6e06b7f428cc9413ea9cd |
|
BLAKE2b-256 | 5bbb5a567fe0c0ae5ef34a1d547666ff712ef5d16ac6d3f5fae1dad315dda652 |
File details
Details for the file fastaparser-1.1.1-py3-none-any.whl
.
File metadata
- Download URL: fastaparser-1.1.1-py3-none-any.whl
- Upload date:
- Size: 29.7 kB
- Tags: Python 3
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/4.0.1 CPython/3.9.13
File hashes
Algorithm | Hash digest | |
---|---|---|
SHA256 | c929f712bd4ea3e6f3569761c6c4fbe798e9a1c4b04d322deb05c8922e731cd4 |
|
MD5 | 3ca1f7e8ffd6659f320d62f8a0e16550 |
|
BLAKE2b-256 | 09f2b29911ca428036cbb78095dd5a1506f85b1868bd37bd49102046e0ab571b |