Skip to main content

Efficient querying of genomic databases directly into programming environments.

Project description

gget

pypi version PyPI - Downloads license DOI status Code Coverage

gget is a free and open-source command-line tool and Python package that enables efficient querying of genomic databases. gget consists of a collection of separate but interoperable modules, each designed to facilitate one type of database querying in a single line of code.

alt text

gget currently consists of the following nine modules:

  • gget ref
    Fetch FTPs and metadata for reference genomes and annotations from Ensembl by species.
  • gget search
    Fetch genes and transcripts from Ensembl using free-form search terms.
  • gget info
    Fetch extensive gene and transcript metadata from Ensembl, UniProt, and NCBI using Ensembl IDs.
  • gget seq
    Fetch nucleotide or amino acid sequences of genes or transcripts from Ensembl or UniProt, respectively.
  • gget blast
    BLAST a nucleotide or amino acid sequence against any BLAST database.
  • gget blat
    Find the genomic location of a nucleotide or amino acid sequence using BLAT.
  • gget muscle
    Align multiple nucleotide or amino acid sequences against each other using Muscle5.
  • gget enrichr
    Perform an enrichment analysis on a list of genes using Enrichr.
  • gget archs4
    Find the most correlated genes or the tissue expression atlas of a gene of interest using ARCHS4.

Installation

pip install gget

For use in Jupyter Lab / Google Colab:

import gget

Quick start guide

# Fetch all Homo sapiens reference and annotation FTPs from the latest Ensembl release
$ gget ref -s homo_sapiens

# Search human genes with "ace2" AND "angiotensin" in their name/description
$ gget search -sw ace2,angiotensin -s homo_sapiens -ao and 

# Look up gene ENSG00000130234 (ACE2) with expanded info (returns all transcript isoforms for genes)
$ gget info -id ENSG00000130234 -e

# Fetch the amino acid sequence of the canonical transcript of gene ENSG00000130234
$ gget seq -id ENSG00000130234 --seqtype transcript

# Quickly find the genomic location of (the start of) that amino acid sequence
$ gget blat -seq MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS

# Blast (the start of) that amino acid sequence
$ gget blast -seq MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS

# Align nucleotide or amino acid sequences stored in a FASTA file
$ gget muscle -fa path/to/file.fa

# Use Enrichr to find the ontology of a list of genes
$ gget enrichr -g ACE2 AGT AGTR1 ACE AGTRAP AGTR2 ACE3P -db ontology

# Get the human tissue expression atlas of gene ACE2
$ gget archs4 -g ACE2 -w tissue

Jupyter Lab / Google Colab:

gget.ref("homo_sapiens")
gget.search(["ace2", "angiotensin"], "homo_sapiens", andor="and")
gget.info("ENSG00000130234", expand=True)
gget.seq("ENSG00000130234", seqtype="transcript")
gget.blat("MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS")
gget.blast("MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS")
gget.muscle("path/to/file.fa")
gget.enrichr(["ACE2", "AGT", "AGTR1", "ACE", "AGTRAP", "AGTR2", "ACE3P"], database="ontology", plot=True)
gget.archs4("ACE2", which="tissue")

Manual

Jupyter Lab / Google Colab arguments are equivalent to long-option arguments (--arg).
The manual for any gget tool can be called from terminal using the -h --help flag.

gget ref

Fetch FTPs and their respective metadata (or use flag ftp to only return the links) for reference genomes and annotations from Ensembl by species.
Return format: dictionary/json.

Required arguments
-s --species
Species for which the FTPs will be fetched in the format genus_species, e.g. homo_sapiens.
Note: Not required when calling flag --list_species.
Supported shortcuts: 'human', 'mouse'

Optional arguments
-w --which
Defines which results to return. Default: 'all' -> Returns all available results.
Possible entries are one or a combination of the following:
'gtf' - Returns the annotation (GTF).
'cdna' - Returns the trancriptome (cDNA).
'dna' - Returns the genome (DNA).
'cds' - Returns the coding sequences corresponding to Ensembl genes. (Does not contain UTR or intronic sequence.)
'cdrna' - Returns transcript sequences corresponding to non-coding RNA genes (ncRNA).
'pep' - Returns the protein translations of Ensembl genes.

-r --release
Defines the Ensembl release number from which the files are fetched, e.g. 104. Default: latest Ensembl release.

-o --out
Path to the json file the results will be saved in, e.g. path/to/directory/results.json. Default: Standard out.
Jupyter Lab / Google Colab: save=True will save the output in the current working directory.

Flags
-l --list_species
Lists all available species. (Jupyter Lab / Google Colab: combine with species=None.)

-ftp --ftp
Returns only the requested FTP links.

-d --download
Downloads the requested FTPs to the current directory (requires curl to be installed).

Examples

Use gget ref in combination with kallisto | bustools to build a reference index:

kb ref -i INDEX -g T2G -f1 FASTA $(gget ref --ftp -w dna,gtf -s homo_sapiens)

→ kb ref builds a reference index using the latest DNA and GTF files of species Homo sapiens passed to it by gget ref.

Get all available genomes:

gget ref --list -r 103
# Jupyter Lab / Google Colab:
gget.ref(species=None, list_species=True, release=103)

→ Returns a list with all available genomes (checks if GTF and FASTAs are available) from Ensembl release 103.
(If no release is specified, gget ref will always return information from the latest Ensembl release.)

Get the genome reference for a specific species:

gget ref -s homo_sapiens -w gtf dna
# Jupyter Lab / Google Colab:
gget.ref("homo_sapiens", which=["gtf", "dna"])

→ Returns a json with the latest human GTF and FASTA FTPs, and their respective metadata, in the format:

{
    "homo_sapiens": {
        "annotation_gtf": {
            "ftp": "http://ftp.ensembl.org/pub/release-106/gtf/homo_sapiens/Homo_sapiens.GRCh38.106.gtf.gz",
            "ensembl_release": 106,
            "release_date": "28-Feb-2022",
            "release_time": "23:27",
            "bytes": "51379459"
        },
        "genome_dna": {
            "ftp": "http://ftp.ensembl.org/pub/release-106/fasta/homo_sapiens/dna/Homo_sapiens.GRCh38.dna.primary_assembly.fa.gz",
            "ensembl_release": 106,
            "release_date": "21-Feb-2022",
            "release_time": "09:35",
            "bytes": "881211416"
        }
    }
}

More examples


gget search

Fetch genes and transcripts from Ensembl using free-form search terms.
Return format: data frame.

Required arguments
-sw --searchwords
One or more free form search words, e.g. gaba, nmda. (Note: Search is not case-sensitive.)

-s --species
Species or database to be searched.
A species can be passed in the format 'genus_species', e.g. 'homo_sapiens'.
To pass a specific database, pass the name of the CORE database, e.g. 'mus_musculus_dba2j_core_105_1'.
All availabale databases can be found here.
Supported shortcuts: 'human', 'mouse'.

Optional arguments
-st --seqtype
'gene' (default) or 'transcript'
Returns genes or transcripts, respectively.

-ao --andor
'or' (default) or 'and'
'or': Returns all genes that INCLUDE AT LEAST ONE of the searchwords in their name/description.
'and': Returns only genes that INCLUDE ALL of the searchwords in their name/description.

-l --limit
Limits the number of search results, e.g. 10. Default: None.

-o --out
Path to the csv the results will be saved in, e.g. path/to/directory/results.csv. Default: Standard out.
Jupyter Lab / Google Colab: save=True will save the output in the current working directory.

Flags
wrap_text
Jupyter Lab / Google Colab only. wrap_text=True displays data frame with wrapped text for easy reading (default: False).

Example

gget search -sw gaba gamma-aminobutyric -s homo_sapiens
# Jupyter Lab / Google Colab:
gget.search(["gaba", "gamma-aminobutyric"], "homo_sapiens")

→ Returns all genes that contain at least one of the search words in their name or Ensembl/external reference description:

ensembl_id gene_name ensembl_description ext_ref_description biotype url
ENSG00000034713 GABARAPL2 GABA type A receptor associated protein like 2 [Source:HGNC Symbol;Acc:HGNC:13291] GABA type A receptor associated protein like 2 protein_coding https://uswest.ensembl.org/homo_sapiens/Gene/Summary?g=ENSG00000034713
. . . . . . . . . . . . . . . . . .

More examples


gget info

Fetch extensive gene and transcript metadata from Ensembl, UniProt, and NCBI using Ensembl IDs.
Return format: data frame.

Required arguments
-id --ens_ids
One or more Ensembl IDs.

Optional arguments
-o --out
Path to the csv the results will be saved in, e.g. path/to/directory/results.csv. Default: Standard out.
Jupyter Lab / Google Colab: save=True will save the output in the current working directory.

Flags
-e --expand
Expands returned information (only for gene and transcript IDs).
For genes, adds information on all known transcripts.
For transcripts, adds information on all known translations and exons.

wrap_text
Jupyter Lab / Google Colab only. wrap_text=True displays data frame with wrapped text for easy reading (default: False).

Example

gget info -id ENSG00000034713 ENSG00000104853 ENSG00000170296 -e 
# Jupyter Lab / Google Colab:
gget.info(["ENSG00000034713", "ENSG00000104853", "ENSG00000170296"], expand=True)

→ Returns extensive information about each requested Ensembl ID in data frame format:

uniprot_id ncbi_gene_id primary_gene_name synonyms protein_names ensembl_description uniprot_description ncbi_description biotype canonical_transcript ...
ENSG00000034713 P60520 11345 GABARAPL2 [ATG8, ATG8C, FLC3A, GABARAPL2, GATE-16, GATE16, GEF-2, GEF2] Gamma-aminobutyric acid receptor-associated protein like 2 (GABA(A) receptor-associated protein-like 2)... GABA type A receptor associated protein like 2 [Source:HGNC Symbol;Acc:HGNC:13291] FUNCTION: Ubiquitin-like modifier involved in intra- Golgi traffic (By similarity). Modulates intra-Golgi transport through coupling between NSF activity and ... Enables ubiquitin protein ligase binding activity. Involved in negative regulation of proteasomal protein catabolic process and protein... protein_coding ENST00000037243.7 ...
. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . ...

More examples


gget seq

Fetch nucleotide or amino acid sequence of a gene (and all its isoforms) or a transcript by Ensembl ID.
Return format: FASTA.

Required arguments
-id --ens_ids
One or more Ensembl IDs.

Optional arguments
-st --seqtype
'gene' (default) or 'transcript'.
Defines whether nucleotide or amino acid sequences are returned.
Nucleotide sequences are fetched from Ensembl.
Amino acid sequences are fetched from UniProt.

-o --out
Path to the file the results will be saved in, e.g. path/to/directory/results.fa. Default: Standard out.
Jupyter Lab / Google Colab: save=True will save the output in the current working directory.

Flags
-i --isoforms
Returns the sequences of all known transcripts.
(Only for gene IDs in combination with seqtype=transcript.)

Examples

gget seq -id ENSG00000034713 ENSG00000104853 ENSG00000170296
# Jupyter Lab / Google Colab:
gget.seq(["ENSG00000034713", "ENSG00000104853", "ENSG00000170296"])

→ Returns the nucleotide sequences of ENSG00000034713, ENSG00000104853, and ENSG00000170296 in FASTA format.

gget seq -id ENSG00000034713 -st transcript -iso
# Jupyter Lab / Google Colab:
gget.seq("ENSG00000034713", seqtype="transcript", isoforms=True)

→ Returns the amino acid sequences of all known transcripts of ENSG00000034713 in FASTA format.

More examples


gget blast

BLAST a nucleotide or amino acid sequence against any BLAST database.
Return format: data frame.

Required arguments
-seq --sequence
Nucleotide or amino acid sequence, or path to FASTA or .txt file.

Optional arguments
-p --program
'blastn', 'blastp', 'blastx', 'tblastn', or 'tblastx'.
Default: 'blastn' for nucleotide sequences; 'blastp' for amino acid sequences.

-db --database
'nt', 'nr', 'refseq_rna', 'refseq_protein', 'swissprot', 'pdbaa', or 'pdbnt'.
Default: 'nt' for nucleotide sequences; 'nr' for amino acid sequences.
More info on BLAST databases

-l --limit
Limits number of hits to return. Default: 50.

-e --expect
Defines the expect value cutoff. Default: 10.0.

-o --out
Path to the csv the results will be saved in, e.g. path/to/directory/results.csv. Default: Standard out.
Jupyter Lab / Google Colab: save=True will save the output in the current working directory.

Flags
-lcf --low_comp_filt
Turns on low complexity filter.

-mbo --megablast_off
Turns off MegaBLAST algorithm. Default: MegaBLAST on (blastn only).

-q --quiet
Prevents progress information from being displayed.

wrap_text
Jupyter Lab / Google Colab only. wrap_text=True displays data frame with wrapped text for easy reading (default: False).

Example

gget blast -seq MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR
# Jupyter Lab / Google Colab:
gget.blast("MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR")

→ Returns the BLAST result of the sequence of interest in data frame format. gget blast automatically detects this sequence as an amino acid sequence and therefore sets the BLAST program to blastp with database nr.

Description Scientific Name Common Name Taxid Max Score Total Score Query Cover ...
PREDICTED: gamma-aminobutyric acid receptor-as... Colobus angolensis palliatus NaN 336983 180 180 100% ...
. . . . . . . . . . . . . . . . . . . . . ...

BLAST from .fa or .txt file:

gget blast -seq fasta.fa
# Jupyter Lab / Google Colab:
gget.blast("fasta.fa")

→ Returns the BLAST results of the first sequence contained in the fasta.fa file.

More examples


gget blat

Find the genomic location of a nucleotide or amino acid sequence using BLAT.
Return format: data frame.

Required arguments
-seq --sequence
Nucleotide or amino acid sequence, or path to FASTA or .txt file.

Optional arguments
-st --seqtype
'DNA', 'protein', 'translated%20RNA', or 'translated%20DNA'.
Default: 'DNA' for nucleotide sequences; 'protein' for amino acid sequences.

-a --assembly
'human' (hg38) (default), 'mouse' (mm39), 'zebrafinch' (taeGut2),
or any of the species assemblies available here (use short assembly name).

-o --out
Path to the csv the results will be saved in, e.g. path/to/directory/results.csv. Default: Standard out.
Jupyter Lab / Google Colab: save=True will save the output in the current working directory.

Example

gget blat -seq MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR -a taeGut2
# Jupyter Lab / Google Colab:
gget.blat("MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR", assembly="taeGut2")

→ Returns BLAT results for assembly taeGut2 (zebra finch) in data frame format. In the above example, gget blat automatically detects this sequence as an amino acid sequence and therefore sets the BLAT seqtype to protein.

genome query_size aligned_start aligned_end matches mismatches %_aligned ...
taeGut2 88 12 88 77 0 87.5 ...

More examples


gget muscle

Align multiple nucleotide or amino acid sequences against each other using Muscle5.
Return format: ClustalW formatted standard out or aligned FASTA.

Required arguments
-fa --fasta
Path to FASTA or .txt file containing the nucleotide or amino acid sequences to be aligned.

Optional arguments
-o --out
Path to the aligned FASTA file the results will be saved in, e.g. path/to/directory/results.afa. Default: Standard out.
Jupyter Lab / Google Colab: save=True will save the output in the current working directory.

Flags
-s5 --super5
Aligns input using the Super5 algorithm instead of the Parallel Perturbed Probcons (PPP) algorithm to decrease time and memory.
Use for large inputs (a few hundred sequences).

wrap_text
Jupyter Lab / Google Colab only. wrap_text=True displays data frame with wrapped text for easy reading (default: False).

Example

gget muscle -fa fasta.fa
# Jupyter Lab / Google Colab:
gget.muscle("fasta.fa")

→ Returns an overview of the aligned sequences with ClustalW coloring. (To return an aligned FASTA (.afa) file, use --out argument (or save=True in Jupyter Lab/Google Colab).) In the above example, the 'fasta.fa' includes several sequences to be aligned (e.g. isoforms returned from gget seq).

alt text

More examples


gget enrichr

Perform an enrichment analysis on a list of genes using Enrichr.
Return format: data frame.

Required arguments
-g --genes
Short names (gene symbols) of genes to perform enrichment analysis on, e.g. 'PHF14 RBM3 MSL1 PHF21A'.

-db --database
Database to use as reference for the enrichment analysis.
Supports any database listed here under 'Gene-set Library' or one of the following shortcuts:
'pathway'       (KEGG_2021_Human)
'transcription'     (ChEA_2016)
'ontology'      (GO_Biological_Process_2021)
'diseases_drugs'   (GWAS_Catalog_2019)
'celltypes'      (PanglaoDB_Augmented_2021)
'kinase_interactions'  (KEA_2015)

Optional arguments
-o --out
Path to the csv the results will be saved in, e.g. path/to/directory/results.csv. Default: Standard out.
Jupyter Lab / Google Colab: save=True will save the output in the current working directory.

Flags
plot
Jupyter Lab / Google Colab only. plot=True provides a graphical overview of the first 15 results (default: False).

Example

gget enrichr -g ACE2 AGT AGTR1 -db ontology
# Jupyter Lab / Google Colab:
gget.enrichr(["ACE2", "AGT", "AGTR1"], database="ontology", plot=True)

→ Returns pathways/functions involving genes ACE2, AGT, and AGTR1 from the GO Biological Process 2021 database in data frame format. In Jupyter Lab / Google Colab, plot=True returns a graphical overview of the results:

alt text

More examples


gget archs4

Find the most correlated genes or the tissue expression atlas of a gene of interest using ARCHS4.
Return format: data frame.

Required arguments
-g --gene
Short name (gene symbol) of gene of interest, e.g. 'STAT4'.

Optional arguments
-w --which
'correlation' (default) or 'tissue'.
'correlation' returns a gene correlation table that contains the 100 most correlated genes to the gene of interest. The Pearson correlation is calculated over all samples and tissues in ARCHS4.
'tissue' returns a tissue expression atlas calculated from human or mouse samples (as defined by 'species') in ARCHS4.

-s --species
'human' (default) or 'mouse'.
Defines whether to use human or mouse samples from ARCHS4.
(Only for tissue expression atlas.)

-o --out
Path to the csv the results will be saved in, e.g. path/to/directory/results.csv. Default: Standard out.
Jupyter Lab / Google Colab: save=True will save the output in the current working directory.

Examples

gget archs4 -g ACE2
# Jupyter Lab / Google Colab:
gget.archs4("ACE2")

→ Returns the 100 most correlated genes to ACE2 in a data frame:

gene_symbol pearson_correlation
SLC5A1 0.579634
CYP2C18 0.576577
. . . . . .
gget archs4 -g ACE2 -w tissue
# Jupyter Lab / Google Colab:
gget.archs4("ACE2", which="tissue")

→ Returns the tissue expression of ACE2 in a data frame (by default, human data is used):

id min q1 median q3 max
System.Urogenital/Reproductive System.Kidney.RENAL CORTEX 0.113644 8.274060 9.695840 10.51670 11.21970
System.Digestive System.Intestine.INTESTINAL EPITHELIAL CELL 0.113644 5.905560 9.570450 13.26470 13.83590
. . . . . . . . . . . . . . . . . .

More examples


Project details


Release history Release notifications | RSS feed

Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

gget-0.0.24.tar.gz (1.2 MB view hashes)

Uploaded Source

Built Distribution

gget-0.0.24-py3-none-any.whl (1.2 MB view hashes)

Uploaded Python 3

Supported by

AWS AWS Cloud computing and Security Sponsor Datadog Datadog Monitoring Fastly Fastly CDN Google Google Download Analytics Microsoft Microsoft PSF Sponsor Pingdom Pingdom Monitoring Sentry Sentry Error logging StatusPage StatusPage Status page