Skip to main content

Efficient querying of genomic databases directly into programming environments.

Project description

gget

pypi version image Downloads Conda license status status Code Coverage

gget is a free, open-source command-line tool and Python package that enables efficient querying of genomic databases. gget consists of a collection of separate but interoperable modules, each designed to facilitate one type of database querying in a single line of code.

alt text

If you use gget in a publication, please cite*:

Luebbert, L., & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836

Read the article here: https://doi.org/10.1093/bioinformatics/btac836

Installation

pip install --upgrade gget

Alternative:

conda install -c bioconda gget

For use in Jupyter Lab / Google Colab:

import gget

🔗 Manual

🪄 Quick start guide

Command line:

# Fetch all Homo sapiens reference and annotation FTPs from the latest Ensembl release
$ gget ref homo_sapiens

# Get Ensembl IDs of human genes with "ace2" or "angiotensin converting enzyme 2" in their name/description
$ gget search -s homo_sapiens 'ace2' 'angiotensin converting enzyme 2'

# Look up gene ENSG00000130234 (ACE2) and its transcript ENST00000252519
$ gget info ENSG00000130234 ENST00000252519

# Fetch the amino acid sequence of the canonical transcript of gene ENSG00000130234
$ gget seq --translate ENSG00000130234

# Quickly find the genomic location of (the start of) the amino acid sequence returned by gget seq
$ gget blat MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS

# BLAST (the start of) the amino acid sequence returned by gget seq
$ gget blast MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS

# Align nucleotide or amino acid sequences stored in a FASTA file
$ gget muscle path/to/file.fa

# Use Enrichr for an ontology analysis of a list of genes
$ gget enrichr -db ontology ACE2 AGT AGTR1 ACE AGTRAP AGTR2 ACE3P

# Get the human tissue expression of gene ACE2
$ gget archs4 -w tissue ACE2

# Get the protein structure (in PDB format) of ACE2 as stored in the Protein Data Bank 
# (PDB IDs can be returned by gget info with flag --pdb)
$ gget pdb 1R42 -o 1R42.pdb

# Fetch an scRNAseq count matrix (AnnData format) based on specified gene(s), tissue(s) and cell type(s) (default species: human)
$ gget setup cellxgene # setup only needs to be run once
$ gget cellxgene --gene ACE2 SLC5A1 --tissue lung --cell_type 'mucus secreting cell' -o example_adata.h5ad

# Predict the protein structure of GFP from its amino acid sequence
$ gget setup alphafold # setup only needs to be run once
$ gget alphafold MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Python (Jupyter Lab / Google Colab):

import gget
gget.ref("homo_sapiens")
gget.search(["ace2", "angiotensin converting enzyme 2"], "homo_sapiens")
gget.info(["ENSG00000130234", "ENST00000252519"])
gget.seq("ENSG00000130234", translate=True)
gget.blat("MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS")
gget.blast("MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS")
gget.muscle("path/to/file.fa")
gget.enrichr(["ACE2", "AGT", "AGTR1", "ACE", "AGTRAP", "AGTR2", "ACE3P"], database="ontology", plot=True)
gget.archs4("ACE2", which="tissue")
gget.pdb("1R42", save=True)

gget.setup("cellxgene") # setup only needs to be run once
gget.cellxgene(gene = ["ACE2", "SLC5A1"], tissue = "lung", cell_type = "mucus secreting cell")

gget.setup("alphafold") # setup only needs to be run once
gget.alphafold("MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK")

Call gget from R using reticulate:

system("pip install gget")
install.packages("reticulate")
library(reticulate)
gget <- import("gget")

gget$ref("homo_sapiens")
gget$search(list("ace2", "angiotensin converting enzyme 2"), "homo_sapiens")
gget$info(list("ENSG00000130234", "ENST00000252519"))
gget$seq("ENSG00000130234", translate=TRUE)
gget$blat("MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS")
gget$blast("MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLAS")
gget$muscle("path/to/file.fa", out="path/to/out.afa")
gget$enrichr(list("ACE2", "AGT", "AGTR1", "ACE", "AGTRAP", "AGTR2", "ACE3P"), database="ontology")
gget$archs4("ACE2", which="tissue")
gget$pdb("1R42", save=TRUE)

More examples

Project details


Release history Release notifications | RSS feed

Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

gget-0.27.8.tar.gz (2.2 MB view hashes)

Uploaded Source

Built Distribution

gget-0.27.8-py3-none-any.whl (2.2 MB view hashes)

Uploaded Python 3

Supported by

AWS AWS Cloud computing and Security Sponsor Datadog Datadog Monitoring Fastly Fastly CDN Google Google Download Analytics Microsoft Microsoft PSF Sponsor Pingdom Pingdom Monitoring Sentry Sentry Error logging StatusPage StatusPage Status page