gradio-sequence-editor 0.0.5

Python library for easily interacting with trained machine learning models

---

tags: [gradio-custom-component, SimpleTextbox] title: gradio_sequence_editor short_description: colorFrom: blue colorTo: yellow sdk: gradio pinned: false app_file: space.py

gradio_sequence_editor

Python library for easily interacting with trained machine learning models

Installation

pip install gradio_sequence_editor

Usage

import gradio as gr
from gradio_sequence_editor import sequence_editor


with gr.Blocks(css=".form { overflow: visible } .sequence_editor { overflow: visible !important; }") as demo:
    sequence = sequence_editor(sequences="ABCDE", width=360, editor_visible=False, elem_classes=['sequence_editor'])
    print_btn = gr.Button('Print')
    def update_sequence():
        return sequence_editor(sequences=""">target
PPKPFFFEAGERAVLLLHGFTGNSADVRMLGRFLESKGY----------GVPPEELVHTG
PDDWWQDVMNGYEFLKNKGYEKIAVAGLSLGGVFSLKLGYTVPIEGIVTMCAPMYIKSEE
TMYEGVLEYAREYKKREGKSEEQIEQEMEKFKQTPMKTLKALQELIADVRDHLDLIYAPT
FVVQARHDEMINPDSANIIYNEIESPVKQIKWYEQSGHVITLDQEKDQLHEDIYAFLESL
DW
>template
PPKPFFFEAGERAVLLLHGFTGNSADVRMLGRFLESKGYTCHAPIYKGHGVPPEELVHTG
PDDWWQDVMNGYEFLKNKGYEKIAVAGLSLGGVFSLKLGYTVPIEGIVTMCAPMYIKSEE
TMYEGVLEYAREYKKREGKSEEQIEQEMEKFKQTPMKTLKALQELIADVRDHLDLIYAPT
FVVQARHDEMINPDSANIIYNEIESPVKQIKWYEQSGHVITLDQEKDQLHEDIYAFLESL
DW""", width=720, toolbar_visible=False)
    print_btn.click(update_sequence, outputs=sequence)

if __name__ == "__main__":
    demo.launch()

sequence_editor

Initialization

name	type	default	description
value	str | Callable | None	None	default text to provide in textbox. If callable, the function will be called whenever the app loads to set the initial value of the component.
placeholder	str | None	None	placeholder hint to provide behind textbox.
label	str | None	None	component name in interface.
every	float | None	None	If `value` is a callable, run the function 'every' number of seconds while the client connection is open. Has no effect otherwise. The event can be accessed (e.g. to cancel it) via this component's .load_event attribute.
show_label	bool | None	None	if True, will display label.
scale	int | None	None	relative size compared to adjacent Components. For example if Components A and B are in a Row, and A has scale=2, and B has scale=1, A will be twice as wide as B. Should be an integer. scale applies in Rows, and to top-level Components in Blocks where fill_height=True.
min_width	int	160	minimum pixel width, will wrap if not sufficient screen space to satisfy this value. If a certain scale value results in this Component being narrower than min_width, the min_width parameter will be respected first.
interactive	bool | None	None	if True, will be rendered as an editable textbox; if False, editing will be disabled. If not provided, this is inferred based on whether the component is used as an input or output.
visible	bool	True	If False, component will be hidden.
rtl	bool	False	If True and `type` is "text", sets the direction of the text to right-to-left (cursor appears on the left of the text). Default is False, which renders cursor on the right.
elem_id	str | None	None	An optional string that is assigned as the id of this component in the HTML DOM. Can be used for targeting CSS styles.
elem_classes	list[str] | str | None	None	An optional list of strings that are assigned as the classes of this component in the HTML DOM. Can be used for targeting CSS styles.
render	bool	True	If False, component will not render be rendered in the Blocks context. Should be used if the intention is to assign event listeners now but render the component later.
key	int | str | None	None	if assigned, will be used to assume identity across a re-render. Components that have the same key across a re-render will have their value preserved.
sequences	str | None	None	None
width	int | None	None	None
toolbar_visible	bool	True	None
editor_visible	bool	True	None
axis_visible	bool	True	None

Events

name	description
change	Triggered when the value of the sequence_editor changes either because of user input (e.g. a user types in a textbox) OR because of a function update (e.g. an image receives a value from the output of an event trigger). See .input() for a listener that is only triggered by user input.
input	This listener is triggered when the user changes the value of the sequence_editor.
submit	This listener is triggered when the user presses the Enter key while the sequence_editor is focused.

User function

The impact on the users predict function varies depending on whether the component is used as an input or output for an event (or both).

• When used as an Input, the component only impacts the input signature of the user function.
• When used as an output, the component only impacts the return signature of the user function.

The code snippet below is accurate in cases where the component is used as both an input and an output.

• As output: Is passed, passes text value as a {str} into the function.
• As input: Should return, expects a {str} returned from function and sets textarea value to it.

def predict(
    value: str | None
) -> str | None:
    return value