Skip to main content

GraphPart

PyPI version PyPI - Downloads PyPIDownloadsTotal Stars

Biological sequence dataset partitioning method

Graph-Part is a Python package for generating partitions (i.e. train-test splits, or splits for cross-validation) of biological sequence datasets. It ensures minimal homology between different partitions, while balancing partitions for labels or other desired criteria.

Preprint: https://www.biorxiv.org/content/10.1101/2023.04.14.536886v1

Installation

GraphPart relies on needleall from the EMBOSS package for Needleman-Wunsch alignments of sequences. Please refer to the official EMBOSS documentation for installation methods. Additionally, GraphPart supports MMseqs2 for alignments. To use other algorithms that compute pairwise similarity measures, please refer to the precomputed mode.

We recommend to install GraphPart in a conda environment, and install EMBOSS from bioconda. The same goes for MMseqs2.

conda install -c bioconda emboss

# If you also want to use the MMseqs2 mode
conda install -c conda-forge -c bioconda mmseqs2 

Alternatively, on Ubuntu, EMBOSS is available directly via sudo apt-get install emboss .

To install GraphPart, run

pip install graph-part

The command graphpart will now be available on your command line.

Alternatively, you can install GraphPart from source:

conda install -c bioconda emboss
git clone https://github.com/graph-part/graph-part.git
cd graph-part
pip install .

Instructions

Command line interface for FASTA data

As an example, this is a basic command for partitioning a dataset at a maximum pairwise cross-partition identity of 30% into 5 folds. The resulting partitions are balanced for equal frequencies of the class labels specified in label= in the FASTA headers. --threads can be adapted according to your system and has no effect on the partitioning itself, it only affects the resource usage and processing speed.

graphpart needle --fasta-file netgpi_dataset.fasta --threshold 0.3 --out-file graphpart_assignments.csv --labels-name label --partitions 5 --threads 12

Alternatively, a train-validation-test split of the data can be made instead of folds:

graphpart needle --fasta-file netgpi_dataset.fasta --threshold 0.3 --out-file graphpart_assignments.csv --labels-name label --test-ratio 0.1 --val-ratio 0.05 --threads 12

Python API

A tutorial notebook showcasing how to use GraphPart from within Python is included at tutorial.ipynb. The tutorial also covers partitioning of small molecule data.

Input format

GraphPart works on FASTA files with a custom header format, e.g.

>P42098|label=CLASSA|priority=0
MAPSWRFFVCFLLWGGTELCSPQPVWQDEGQRLRPSKPPTVMVECQEAQLVVIVSKDLFGTGKLIRPADL
>P0CL66|label=CLASSB|priority=1
MKKYLLGIGLILALIACKQNVSSLDEKNSVSVDLPGEMKVLVSKEKNKDGKYDLIATVDKLELKGTSDKN

Alternatively , ":" and " - " (note there are spaces on either side of the -) can be used as separators instead of "|". It should be taken care that the sequence identifiers themselves contain no separator symbols. The keywords label and priority can be customized by specifying the --labels-name and --priority-name arguments. Both elements of the header are optional, GraphPart can also just partition based on sequences alone, without any class balancing.
You can find a script to convert .csv datasets into the custom .fasta format at csv_to_fasta.py

Output format

GraphPart produces a .csv file that contains the cluster assignment for each sequence. Column cluster contains the partition number. Removed sequences are not contained in the output file.

AC,priority,label-val,between_connectivity,cluster
P42098,False,0,0,0.0
Q6LEM5,False,0,0,0.0
Q9JI81,False,0,0,1.0

API

Minimal command:

graphpart ALIGNMENT_MODE -ff FASTAFILE.fasta -th 0.3

Supported aligners

Alignment mode Description
needle Use EMBOSS needleall to compute exact pairwise global Needleman-Wunsch (NW) identities for all sequences.
mmseqs2 Use MMseqs2 to compute fast identities from local alignments. Use with caution for nucleotides, as there it cannot be guaranteed that MMseqs2 computes all pairwise alignments.
precomputed Use a list of precomputed identities or other similarity/distance metrics.
mmseqs2needle Uses MMseqs2 to compute fast identities, followed by recomputation of NW identities of all identities between the separation threshold and an user-defined lower threshold.

Arguments

Shared

Long Short Description
--fasta-file -ff Path to the input fasta file, formatted according to the input format.
--out-file -of Path at which to save the partition assignments as .csv. Defaults to graphpart_result.csv.
--threshold -th The desired partitioning threshold, should be within the bounds defined by the metric.
--partitions -pa Number of partitions to generate. Defaults to 5.
--transformation -tf Transformation to apply to the similarity/distance metric. GraphPart operates on distances, therefore similarity metrics need to be transformed. Can be any of one-minus, inverse, square, log, None. See the source for definitions. As an example, when operating with sequence identities ranging from 0 to 1, the transformation one-minus yields corresponding distances. Defaults to one-minus.
--priority-name -pn The name of the retention priority in the meta file. Is either =0 or =1. If specified, the algorithm first tries to reach the treshold by removing/moving low-priority (0) samples before proceeding to 1 samples.
--labels-name -ln The name of the label in the meta file. Used for balancing partitions.
--initialization-mode -im Use either slow or fast restricted nearest neighbor linkage or no initialization. Can be any of slow-nn, fast-nn, simple. Defaults to slow-nn.
--no-moving -nm By default, the removing procedure tries to relocate sequences to another partition if it finds more within-threshold neighbours in any. This flag disallows moving. In high-redundancy datasets, moving can lead to imbalanced partitions and should be disabled.
--save-checkpoint-path -sc Optional path to save the computed identities above the chosen threshold as an edge list. Can be used to quickstart runs in the precomputed mode. Defaults to None with no file saved.
--test-ratio -te Make a train-val-test split instead of partitions for cross-validation. Overrides --partitions when specified. Defaults to 0. Needs to be a multiple of 0.05.
--val-ratio -va Make a train-val-test split instead of partitions for cross-validation. Overrides --partitions when specified. Defaults to 0. Needs to be a multiple of 0.05.

needle

Long Short Description
--denominator -dn Denominator to use for percent sequence identity computation. The number of perfect matching positions is divided by the result of this operation. Can be any of shortest, longest, mean, full, no_gaps. The first three options are computed from the original lengths of the aligned sequences. full refers to the full length of the alignment, including gaps, and is the default. no_gaps subtracts gaps from the full alignment length.
--threads -nt The number of threads to run in parallel. If -1, will use all available resources. Defaults to 1.
--chunks -nc The number of chunks into which to split the fasta file for multithreaded alignment. Defaults to 10.
--parallel-mode -pm The Python parallelization strategy to use. multithread or multiprocess. Multiprocessing is potentially faster (especially for short sequences), but increases memory usage. Defaults to multithread
--nucleotide -nu Use this flag if the input contains nucleotide sequences. By default, assumes proteins.
--triangular -tr Only compute triangular of the full distance matrix. Twice as fast, but can yield slightly different results if an alignment has two different solutions with the same score, but different identities. In some cases, a pairwise identity can be slightly above the threshold in one solution, and slightly below in another (e.g A:B = 29.8%, B:A = 30.4%).
--gapopen -gapopen [10.0 for any sequence] The gap open penalty is the score taken away when a gap is created. The best value depends on the choice of comparison matrix. The default value assumes you are using the EBLOSUM62 matrix. (Floating point number from 1.0 to 100.0)
--gapextend -gapextend [0.5 for any sequence] The gap extension penalty is added to the standard gap penalty for each base or residue in the gap. This is how long gaps are penalized. Usually you will expect a few long gaps rather than many short gaps, so the gap extension penalty should be lower than the gap penalty. An exception is where one or both sequences are single reads with possible sequencing errors in which case you would expect many single base gaps. You can get this result by setting the gap open penalty to a very low value and using the gap extension penalty to control gap scoring. (Floating point number from 0.0 to 10.0)
--endextend -endextend [0.5 for any sequence] The end gap extension, penalty is added to the end gap penalty for each base or residue in the end gap. This is how long end gaps are penalized. (Floating point number from 0.0 to 10.0)
--endweight -endweight Flag. Apply end gap penalties.
--endopen -endopen [10.0 for any sequence] The end gap open penalty is the score taken away when an end gap is created. The best value depends on the choice of comparison matrix. The default value assumes you are using the EBLOSUM62 matrix for protein sequences. (Floating point number from 1.0 to 100.0)
--matrix -datafile This is the scoring matrix file used when comparing sequences. By default it is the file 'EBLOSUM62'. These files are found in the 'data' directory of the EMBOSS installation.

mmseqs2

Long Short Description
--denominator -dn Denominator to use for percent sequence identity computation. The number of perfect matching positions is divided by the result of this operation. Can be any of shortest, longest, n_aligned. n_aligned is the length of the alignment. Use this with caution, as GraphPart doesn't use coverage controls in the mmseqs2 mode. Defaults to shortest.
--nucleotide -nu Use this flag if the input contains nucleotide sequences. By default, assumes proteins. Use with caution! Not guaranteed to compute all pairwise alignments.
--prefilter -pr Use MMseqs2 prefiltering at the highest sensitivity instead of forcing computation of all-vs-all alignments.

precomputed

Long Short Description
--edge-file -ef Path to a comma separated file containing precomputed pairwise metrics, the first two columns should contain sequence identifiers specified in the --fasta-file. This is can be used to run GraphPart with an alignment tool different from the default needleall and mmseqs.
--metric-column -mc Specifies in which column the metric is found. Indexing starts at 0, defaults to 2 when left unspecified.

mmseqs2needle

This mode combines needle and mmseqs2. After a first run of mmseqs2, all pairwise alignments with an indentity below recompute-threshold are computed using needle. Only then the partitioning is performed. Note that if recompute-threshold is very low, it can be faster to just run in needle mode. All arguments for the two modes are reused here, with the following exceptions:

Long Short Description
--recompute-threshold -re The threshold for MMseqs2 above which alignments should be recomputed using needleall. Has to be a number lower than --threshold.
--denominator-mmseqs -dnm Replaces --denominator. Applies to the mmseqs2 alignment step.
--denominator-needle -dnn Replaces --denominator. Applies to the needle alignment step.

Citation

GraphPart: Homology partitioning for biological sequence analysis
Felix Teufel, Magnús Halldór Gíslason, José Juan Almagro Armenteros, Alexander Rosenberg Johansen, Ole Winther, Henrik Nielsen
bioRxiv 2023.04.14.536886; doi: https://doi.org/10.1101/2023.04.14.536886

FAQ

  • How should I pick chunks ?
    chunks should be picked so that all threads are utilized. Each chunk is aligned to each other chunk, so threads <= chunks*chunks results in full utilization.

  • I want to test multiple thresholds and partitioning parameters - How can I do this efficiently ?
    When constructing the graph, we only retain identities that are larger than the selected threshold, as only those form relevant edges for partitioning the data. All other similarities are discarded as they are computed. To test multiple thresholds, the most efficient way is to first try the lowest threshold to be considered and save the edge list by specifying --save-checkpoint-path EDGELIST.csv. In the next run, use graphpart precomputed -ef EDGELIST.csv to start directly from the previous alignment result.

  • GraphPart starts with nicely balanced partitions, but after homology removal the sizes are very imbalanced.
    By default, GraphPart tries to retain as many sequences as possible. In cases where the initialization clustering is far away from a valid solution (this happens when there are a lot of classes, with potentially small counts, and when there is high overall sequence similarity in the data), moving sequences between partitions will cause some partitions to grow large at the expense of others. You can try --no-moving to prevent this behaviour.

  • I want to use a different similarity metric than sequence identity. GraphPart can be used with any similarity or distance metric. To do so, you need to provide a list of precomputed pairwise similarities in the precomputed mode. The first two columns of the file should contain the sequence identifiers specified in the --fasta-file. The third column should contain the similarity metric. The --metric-column argument can be used to specify the column index. If you want to use a similarity metric, you need to specify a transformation using --transformation. See the source for definitions. As an example, when operating with sequence identities ranging from 0 to 1, the transformation one-minus yields corresponding distances. If your metric is a distance, you can use --transformation None to skip the transformation step.

  • I want to use a different alignment tool than EMBOSS needleall or MMseqs. This is supported by the precomputed mode. Please refer to the answer above.

  • How does the moving step decide to which partition to move a sequence to? After initialization of the partitions, GraphPart iteratively moves sequences between partitions and removes sequences from the data to achieve homology separation. For each sequence, we compute how many connections it has to sequences in each other partition. If there are partitions with more connections than the current partition, the sequence is moved to the partition with the maximum number of connections. If there is a tie in the number of connections, the sequence is moved to the partition that appeared first when iterating the underlying graph data structure. We do not explicitly control this order.

Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

graph-part-1.0.2.tar.gz (39.6 kB view details)

Uploaded Source

Built Distribution

If you're not sure about the file name format, learn more about wheel file names.

graph_part-1.0.2-py3-none-any.whl (40.0 kB view details)

Uploaded Python 3

File details

Details for the file graph-part-1.0.2.tar.gz.

File metadata

  • Download URL: graph-part-1.0.2.tar.gz
  • Upload date:
  • Size: 39.6 kB
  • Tags: Source
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/4.0.2 CPython/3.9.17

File hashes

Hashes for graph-part-1.0.2.tar.gz
Algorithm Hash digest
SHA256 398ea49d514511eee6b833b5b780be95591f77915f4224fe68ef28ddf1fae8b7
MD5 7c84263630d6f281941a191e1548072e
BLAKE2b-256 97a13479af737e18a06aca89434f08bfb4c9ccfe729766e952ac6d4670ac0f5e

See more details on using hashes here.

File details

Details for the file graph_part-1.0.2-py3-none-any.whl.

File metadata

  • Download URL: graph_part-1.0.2-py3-none-any.whl
  • Upload date:
  • Size: 40.0 kB
  • Tags: Python 3
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/4.0.2 CPython/3.9.17

File hashes

Hashes for graph_part-1.0.2-py3-none-any.whl
Algorithm Hash digest
SHA256 4366ef1bd443cadaef23e99b9bd9e5344df7457bf7c68a3cd0145c7f33ccde00
MD5 3ab0ae042f69d08fca1a357373c9e6d8
BLAKE2b-256 c5a7dec7022a955c0b7c83508bd63c2e9f0fbb289717bbaf1cb0fd639e7ec06a

See more details on using hashes here.

Release history Release notifications | RSS feed

This release

1.0.2 This release

2 files

1.0.1

2 files

0.1.2

2 files

0.1.1

1 file

0.1

1 file

Anthropic, PBC Visionary sponsor Bloomberg Visionary sponsor Hudson River Trading Visionary sponsor Meta Visionary sponsor NVIDIA Visionary sponsor Microsoft Sustainability sponsor Depot Continuous Integration AWS Cloud computing and Security Sponsor Datadog Monitoring Fastly CDN Google Download Analytics Sentry Error logging StatusPage Status page