No project description provided
Project description
✨ Run large protein models in less than 30 seconds with Modal. Open an issue if it takes longer! ✨
Running large models and code that scales for big datasets in this repository is enabled by Modal (no affiliation). It allows us to run code in the cloud on thousands of containers and GPUs without having to think for a second about infrastructure.
Currently implemented
- ESMFold
- ProteinMPNN
- Parallelized codon optimization with DNAChisel
Up Next
- RFDiffusion
- EvoProtGrad
- Evodiff
⚙️ Getting started
- Create an account at modal.com.
- Open a terminal and run (requires Python 3.10+):
pip install helixbio
- Run
modal token new
🧬 Run your first model
Let's predict a protein structure using ESMFold. This also works in parallel for multiple sequences.
modal run helix.esm::predict_structures_from_fasta --fasta-file "my_lovely_proteins.fasta" --output-dir "my_lovely_structures"
Examples
Generate protein variants using EvoProtGrad.
modal run helix.evoprotgrad::get_evoprotgrad_variants --sequence "MSGKIDKILIVGGGTAGWMAASYLGKALQGTADITLLQAPDIP" --max-mutations 4 --num-chains 20 --n-steps 200 --output-csv-file "my-variants.csv" --output-fasta-file "my-variants.fasta"
Contributing
We welcome contributions of any size! Below are some good ways to get started.
- GitHub Discussions: A great way to talk about features you want added or things that are confusing/need clarification.
- GitHub Issues: These are an excellent way to report bugs. Additionally, you can try and solve an existing issue and submit a PR.
We are actively looking for contributors, no matter your skill level or experience.
License
Helix is open-source and licensed under the Apache License 2.0.
Project details
Release history Release notifications | RSS feed
Download files
Download the file for your platform. If you're not sure which to choose, learn more about installing packages.