IEDB API Tools Python SDK
Python SDK for Immune Epitope Database (IEDB) Analysis Tools API. Includes support for the following prediction tools:
- MHC-I peptide binding:
- Determine sequence's ability to bind to MHC class I molecule
- MHC-II peptide binding:
- Determine sequence's ability to bind to MHC class II molecule
- T-cell epitope prediction:
- Use predictors to determine peptide's potential of being a T-cell epitope
- MHC-Natural Peptide:
- Assess probability that peptide is naturally processed by the MHC
- Antibody epitope prediction:
- Predict B-cell epitopes from protein sequence(s)
View the web application
Installation
Run the following to install:
pip install iedb
Usage
import iedb
# Send POST request to MHC class I peptide binding prediction tool:
mhci_res = iedb.query_mhci_binding(method="recommended", sequence="ARFTGIKTA", allele="HLA-A*02:01", length=8)
# Send POST request to MHC class II peptide binding prediction tool:
mhcii_res = iedb.query_mhcii_binding(method="nn_align", sequence="SLYNTVATLYCVHQRIDV", allele="HLA-DRB1*01:01", length=None)
# Send POST request to T-cell epitope prediction tool:
tcell_res = iedb.query_tcell_epitope(method="smm", sequence="SLYNTVATLYCVHQRIDV", allele="HLA-A*01:01", length=9, proteasome='immuno')
# Send POST request to peptide prediction tool:
pep_res = iedb.query_peptide_prediction(method="mhcnp", sequence="SLYNTVATLYCVHQRIDV", allele="HLA-A*02:01", length=9)
# Send POST request to B-cell epitope prediction tool:
bcell_res = iedb.query_bcell_epitope(method="Emini", sequence="VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTE", window_size=9)
Download files
Download the file for your platform. If you're not sure which to choose, learn more about installing packages.
Source Distribution
iedb-0.0.2.tar.gz
(5.9 kB
view details)
Built Distribution
Filter files by name, interpreter, ABI, and platform.
If you're not sure about the file name format, learn more about wheel file names.
Copy a direct link to the current filters
iedb-0.0.2-py3-none-any.whl
(6.6 kB
view details)
File details
Details for the file iedb-0.0.2.tar.gz.
File metadata
- Download URL: iedb-0.0.2.tar.gz
- Upload date:
- Size: 5.9 kB
- Tags: Source
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/3.4.1 importlib_metadata/4.0.1 pkginfo/1.7.0 requests/2.25.1 requests-toolbelt/0.9.1 tqdm/4.60.0 CPython/3.8.7
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
68a858867f528b3bed2f5ef57d9e0f238110da4cedc78871486637f46e293c07
|
|
| MD5 |
ef6ca3d836d82b235598f8e55499490a
|
|
| BLAKE2b-256 |
9ded7e224ac70afdeaeda27ad69bb73616b2cb7371772ffb2991debfcfbb4fbf
|
File details
Details for the file iedb-0.0.2-py3-none-any.whl.
File metadata
- Download URL: iedb-0.0.2-py3-none-any.whl
- Upload date:
- Size: 6.6 kB
- Tags: Python 3
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/3.4.1 importlib_metadata/4.0.1 pkginfo/1.7.0 requests/2.25.1 requests-toolbelt/0.9.1 tqdm/4.60.0 CPython/3.8.7
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
09dc57b589d5c99b364170ae4d6fb6c5b4d3197e444db6eda4ffe077d2da09e2
|
|
| MD5 |
37162614cc9298b2d889b16d7aa3c9b2
|
|
| BLAKE2b-256 |
23a59f138c1c820a952b3e38ecb3cc68ccb14c9622d079188ede3601cd6f882d
|