Skip to main content

IEDB API Tools Python SDK

PyPI version fury.io Build Status codecov

Python SDK for Immune Epitope Database (IEDB) Analysis Tools API. Includes support for the following prediction tools:

  • MHC-I peptide binding:
    • Determine sequence's ability to bind to MHC class I molecule
  • MHC-II peptide binding:
    • Determine sequence's ability to bind to MHC class II molecule
  • T-cell epitope prediction:
    • Use predictors to determine peptide's potential of being a T-cell epitope
  • MHC-Natural Peptide:
    • Assess probability that peptide is naturally processed by the MHC
  • Antibody epitope prediction:
    • Predict B-cell epitopes from protein sequence(s)

View the web application

Installation

Run the following to install:

pip install iedb

Usage

import iedb

# Send POST request to MHC class I peptide binding prediction tool:
mhci_res = iedb.query_mhci_binding(method="recommended", sequence="ARFTGIKTA", allele="HLA-A*02:01", length=8)

# Send POST request to MHC class II peptide binding prediction tool:
mhcii_res = iedb.query_mhcii_binding(method="nn_align", sequence="SLYNTVATLYCVHQRIDV", allele="HLA-DRB1*01:01", length=None)

# Send POST request to T-cell epitope prediction tool:
tcell_res = iedb.query_tcell_epitope(method="smm", sequence="SLYNTVATLYCVHQRIDV", allele="HLA-A*01:01", length=9, proteasome='immuno')

# Send POST request to peptide prediction tool:
pep_res = iedb.query_peptide_prediction(method="mhcnp", sequence="SLYNTVATLYCVHQRIDV", allele="HLA-A*02:01", length=9)

# Send POST request to B-cell epitope prediction tool:
bcell_res = iedb.query_bcell_epitope(method="Emini", sequence="VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTE", window_size=9)

Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

iedb-0.0.2.tar.gz (5.9 kB view details)

Uploaded Source

Built Distribution

If you're not sure about the file name format, learn more about wheel file names.

iedb-0.0.2-py3-none-any.whl (6.6 kB view details)

Uploaded Python 3

File details

Details for the file iedb-0.0.2.tar.gz.

File metadata

  • Download URL: iedb-0.0.2.tar.gz
  • Upload date:
  • Size: 5.9 kB
  • Tags: Source
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.4.1 importlib_metadata/4.0.1 pkginfo/1.7.0 requests/2.25.1 requests-toolbelt/0.9.1 tqdm/4.60.0 CPython/3.8.7

File hashes

Hashes for iedb-0.0.2.tar.gz
Algorithm Hash digest
SHA256 68a858867f528b3bed2f5ef57d9e0f238110da4cedc78871486637f46e293c07
MD5 ef6ca3d836d82b235598f8e55499490a
BLAKE2b-256 9ded7e224ac70afdeaeda27ad69bb73616b2cb7371772ffb2991debfcfbb4fbf

See more details on using hashes here.

File details

Details for the file iedb-0.0.2-py3-none-any.whl.

File metadata

  • Download URL: iedb-0.0.2-py3-none-any.whl
  • Upload date:
  • Size: 6.6 kB
  • Tags: Python 3
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.4.1 importlib_metadata/4.0.1 pkginfo/1.7.0 requests/2.25.1 requests-toolbelt/0.9.1 tqdm/4.60.0 CPython/3.8.7

File hashes

Hashes for iedb-0.0.2-py3-none-any.whl
Algorithm Hash digest
SHA256 09dc57b589d5c99b364170ae4d6fb6c5b4d3197e444db6eda4ffe077d2da09e2
MD5 37162614cc9298b2d889b16d7aa3c9b2
BLAKE2b-256 23a59f138c1c820a952b3e38ecb3cc68ccb14c9622d079188ede3601cd6f882d

See more details on using hashes here.

Supported by

AWS Cloud computing and Security Sponsor Datadog Monitoring Depot Continuous Integration Fastly CDN Google Download Analytics Sentry Error logging StatusPage Status page