No project description provided
Project description
IgLM
Official repository for IgLM: Generative Language Modeling for Antibody Design
The code and pre-trained models from this work are made available for non-commercial use under the terms of the JHU Academic Software License Agreement.
Setup
To use IgLM, install via pip:
pip install iglm
Alternatively, you can clone this repository and install the package locally:
Command line usage
IgLM supports sequence infilling, sequence generation (with prompting), and sequence evaluation from the command line.
Re-design spans of an antibody sequence
To use IgLM to re-design spans of an antibody sequence, supply the fasta file, the fasta record ID corresponding to the sequence to design, the start index of the span (0-indexed), and the end index of the span (0-indexed, exclusive).
To generate 100 unique sequences of the anti-tissue factor antibody (1JPT) heavy chain with an IgLM-designed CDR3:
iglm_infill data/antibodies/1jpt/1jpt.fasta :H 98 106 --chain_token [HEAVY] --species_token [HUMAN] --num_seqs 100
Full antibody sequence generation
IgLM can be used to generate full antibody sequences while conditioning on the chain type and species-of-origin. See Appendix A.5 for starting tokens and sampling temperatures used for the results in the paper.
To generate 100 unique human heavy chain sequences starting with EVQ:
iglm_generate --prompt_sequence EVQ --chain_token [HEAVY] --species_token [HUMAN] --num_seqs 100
To generate 100 unique nanobody sequences starting with QVQ:
iglm_generate --prompt_sequence QVQ --chain_token [HEAVY] --species_token [CAMEL] --num_seqs 100
Sequence evaluation
IgLM can be used to calculate the log likelihood of a sequence given a chain type and species-of-origin.
Full sequence log likelihood calculation:
iglm_evaluate data/antibodies/1jpt/1jpt.fasta :H --chain_token [HEAVY] --species_token [HUMAN]
Infilled sequence log likelihood calculation:
iglm_evaluate data/antibodies/1jpt/1jpt.fasta :H --start 98 --end 106 --chain_token [HEAVY] --species_token [HUMAN]
Package usage
IgLM may also be used as a Python package, enabling the above use cases and more flexible usage.
Re-design spans of an antibody sequence
To use IgLM to re-design spans of an antibody sequence, supply the fasta file, the fasta record ID corresponding to the sequence to design, the start index of the span (0-indexed), and the end index of the span (0-indexed, exclusive).
To generate 100 unique sequences of the anti-tissue factor antibody (1JPT) heavy chain with an IgLM-designed CDR3:
from iglm import IgLM
iglm = IgLM()
parent_sequence = "EVQLVESGGGLVQPGGSLRLSCAASGFNIKEYYMHWVRQAPGKGLEWVGLIDPEQGNTIYDPKFQDRATISADNSKNTAYLQMNSLRAEDTAVYYCARDTAAYFDYWGQGTLVTVS"
chain_token = "[HEAVY]"
species_token = "[HUMAN]"
infill_range = (98, 106)
num_seqs = 100
generated_seqs = iglm.infill(
parent_sequence,
chain_token,
species_token,
infill_range=infill_range,
num_to_generate=num_seqs,
)
Full antibody sequence generation
IgLM can be used to generate full antibody sequences while conditioning on the chain type and species-of-origin. See Appendix A.5 for starting tokens and sampling temperatures used for the results in the paper.
To generate 100 unique human heavy chain sequences starting with EVQ:
from iglm import IgLM
iglm = IgLM()
prompt_sequence = "EVQ"
chain_token = "[HEAVY]"
species_token = "[HUMAN]"
num_seqs = 100
generated_seqs = iglm.generate(
chain_token,
species_token,
prompt_sequence=prompt_sequence,
num_to_generate=num_seqs,
)
To generate 100 unique nanobody sequences starting with QVQ:
from iglm import IgLM
iglm = IgLM()
prompt_sequence = "QVQ"
chain_token = "[HEAVY]"
species_token = "[CAMEL]"
num_seqs = 100
generated_seqs = iglm.generate(
chain_token,
species_token,
prompt_sequence=prompt_sequence,
num_to_generate=num_seqs,
)
Sequence evaluation
IgLM can be used to calculate the log likelihood of a sequence given a chain type and species-of-origin.
Full sequence log likelihood calculation:
import math
from iglm import IgLM
iglm = IgLM()
sequence = "EVQLVESGGGLVQPGGSLRLSCAASGFNIKEYYMHWVRQAPGKGLEWVGLIDPEQGNTIYDPKFQDRATISADNSKNTAYLQMNSLRAEDTAVYYCARDTAAYFDYWGQGTLVTVS"
chain_token = "[HEAVY]"
species_token = "[HUMAN]"
log_likelihood = iglm.log_likelihood(
sequence,
chain_token,
species_token,
infill_range=infill_range,
)
perplexity = math.exp(-ll)
Infilled sequence log likelihood calculation:
import math
from iglm import IgLM
iglm = IgLM()
sequence = "EVQLVESGGGLVQPGGSLRLSCAASGFNIKEYYMHWVRQAPGKGLEWVGLIDPEQGNTIYDPKFQDRATISADNSKNTAYLQMNSLRAEDTAVYYCARDTAAYFDYWGQGTLVTVS"
chain_token = "[HEAVY]"
species_token = "[HUMAN]"
infill_range = (98, 106)
log_likelihood = iglm.log_likelihood(
sequence,
chain_token,
species_token,
infill_range=infill_range,
)
perplexity = math.exp(-ll)
Project details
Release history Release notifications | RSS feed
Download files
Download the file for your platform. If you're not sure which to choose, learn more about installing packages.