IPC is a program (available also as web service at isoelectric.org) for the accurate estimation of protein and peptide isoelectric point (pI) using Henderson-Hasselbach equation and pKa sets.
It allows you to compute theoretical pI using 16 pKa sets (for individual references see http://isoelectric.org/theory.html)
IPC introduce also two new computationally optimized pKa sets. They were benchmarked against 14 different pKa sets and 3 pI prediction programs on two protein databases (2,324 proteins) and three peptide datasets (16,882 peptides).
Program is written in Python programing language and thus it should be able to run it on any operating system.
AUTHOR: Lukasz Pawel Kozlowski, lukaszkozlowski.lpk@gmail.com COPYRIGHTS: Lukasz Pawel Kozlowski LICENCE: PUBLIC DOMAIN http://isoelectric.org/license.txt
How to cite:
Kozlowski LP (2016) IPC - Isoelectric Point Calculator. Biology Direct 11:55. doi: http://dx.doi.org/10.1186/s13062-016-0159-9
INSTALLATION:
wget http://isoelectric.org/ipc.zip; unzip ipc.zip; # sudo apt-get install unzip (if not present) cd ipc; sudo python setup.py install
USAGE:
python ipc.py <fasta_file> <output_file> <plot_file>
ipc <fasta_file> <output_file> <plot_file> (if installed into system using setup.py)
<fasta_file> protein sequence(s) in fasta format, see ./examples
<pKa set> one from pKa sets which will be used to calculate pI, default 'ALL' (report pI using all models)
valid options are:
'ALL', 'IPC_protein', 'IPC_peptide',
'Bjellqvist', 'Dawson', 'Grimsley',
'Toseland', 'EMBOSS', 'Kozlowski',
'DTASelect', 'Wikipedia', 'Rodwell',
'Patrickios', 'Sillero', 'Thurlkill',
'Solomon', 'Nozaki_Tanford',
'Lehninger', 'ProMoST'
<output_file> output of the program with pI predicted using selected model(s), default name <fasta_file>.pI.txt
<plot_file> virtual 2D-PAGE scatter plot (molecular weight vs. isoelectric point) represented as heat map,
this option is available only if numpy and matplotlib and scipy are installed
E.g. ipc ./examples/NC_010473_Ecoli.faa ALL out.txt out.png
The result should be following files located in the <fasta_file> directory:
- NC_010473_Ecoli.faa.pI.txt with predictions
- NC_010473_Ecoli.faa.png with virtual 2D-PAGE scatter plot
Please note that this exemplary command will predict isoelectric point using all pKa sets for the whole E.coli proteome (4218 proteins). Nevertheless, it should be done in ~5 seconds.
Please, follow the order of input files and parameters. Intentionally, IPC does not use optparse or argparse as those packages are different for different version of python. And their names also may change in future.
Additionally, IPC can be used interactively in python shell:
from isoelectric import ipc
help(ipc)
Help on module ipc:
NAME ipc
FILE /home/lukaskoz/IPC_standalone_version/ipc.py
FUNCTIONS
calculate_molecular_weight(seq)
molecular weight
check_additional_libraries()
check libraries for plotting
error_information()
information how to run IPC script
fasta_reader(fasta_string)
reads fasta file and return table [ [head1, seq1], [head2, seq2], ...]
it is endure for all errors like: multiple line for sequence, white spaces etc.
ipc_author_information()
add information about IPC
make_heat_map(mw_tab, pI_tab, fasta_file, input_pKa_set)
virtual 2D-PAGE scatter plot, heat map
predict_isoelectric_point(sequence, input_pKa_set)
accurate estimation of protein and peptide isoelectric point (pI)
using Henderson-Hasselbach equation and pKa sets
predict_isoelectric_point_ProMoST(seq)
Calculate isoelectric point using ProMoST model
DATA
__author__ = 'Lukasz Pawel Kozlowski'
__copyrights__ = 'Lukasz Pawel Kozlowski'
__email__ = 'lukaszkozlowski.lpk@gmail.com'
__licence__ = 'http://isoelectric.org/licence.txt'
__webserver__ = 'http://isoelectric.org'
aaDict = {'Ala': 'A', 'Arg': 'R', 'Asn': 'N', 'Asp': 'D', 'Asx': 'B', ...
acidic = ['D', 'E', 'C', 'Y']
basic = ['K', 'R', 'H']
promost = {'C': [8.0, 8.28, 9.0], 'D': [3.57, 4.07, 4.57], 'E': [4.15,...
promost_mid = {'A': [7.58, 3.75], 'B': [7.46, 3.57], 'C': [8.12, 3.1],...
sample_protein_sequence = 'MKKMQSIVLALSLVLVAPMAAQAAEITLVPSVKLQIGDRDNRG...
scales = {'Bjellqvist': {'C': 9.0, 'Cterm': 3.55, 'D': 4.05, 'E': 4.45...
AUTHOR Lukasz Pawel Kozlowski
In [1]: import ipc
In [2]: ipc.scales.keys()
Out[2]:
['DTASelect',
'IPC_protein',
'Lehninger',
'Bjellqvist',
'Toseland',
'Wikipedia',
'Grimsley',
'Patrickios',
'Rodwell',
'Solomon',
'IPC_peptide',
'Sillero',
'Dawson',
'EMBOSS',
'Nozaki',
'Thurlkill']
In [3]: sequence = ipc.sample_protein_sequence
In [4]: sequence
Out[4]: 'MKKMQSIVLALSLVLVAPMAAQAAEITLVPSVKLQIGDRDNRGYYWDGGHWRDHGWWKQHYEWRGNRWHLHGPPPPPRHHKKAPHDHHGGHGPGKHHR'
In [5]: ipc.predict_isoelectric_point_ProMoST(sequence)
Out[5]: 10.159912109374998
In [6]: ipc.predict_isoelectric_point(sequence)
Out[6]: 9.779560546874999
In [7]: ipc.predict_isoelectric_point(sequence, 'IPC_protein')
Out[7]: 9.779560546874999
In [8]: ipc.predict_isoelectric_point(sequence, 'IPC_peptide')
Out[8]: 10.569521484375
In [9]: ipc.predict_isoelectric_point(sequence, 'EMBOSS')
Out[9]: 10.774326171875
...
Download files
Download the file for your platform. If you're not sure which to choose, learn more about installing packages.
Source Distribution
Built Distribution
Filter files by name, interpreter, ABI, and platform.
If you're not sure about the file name format, learn more about wheel file names.
Copy a direct link to the current filters
File details
Details for the file isoelectric-1.0.tar.gz.
File metadata
- Download URL: isoelectric-1.0.tar.gz
- Upload date:
- Size: 1.3 MB
- Tags: Source
- Uploaded using Trusted Publishing? No
- Uploaded via:
twine/1.14.0 pkginfo/1.5.0.1 requests/2.18.4 setuptools/39.1.0 requests-toolbelt/0.9.1 tqdm/4.28.1 CPython/3.6.8
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
76fe7ee81f4645222c4658a2cd855d66930c513eb976476485c436dec1228b33
|
|
| MD5 |
8ec03da715de9c280e6177772faa20ba
|
|
| BLAKE2b-256 |
41e900820750a6de8f7e95efd607ce9e8d2351ef5f2424edc74d6823fdce8079
|
File details
Details for the file isoelectric-1.0-py3-none-any.whl.
File metadata
- Download URL: isoelectric-1.0-py3-none-any.whl
- Upload date:
- Size: 9.4 kB
- Tags: Python 3
- Uploaded using Trusted Publishing? No
- Uploaded via:
twine/1.14.0 pkginfo/1.5.0.1 requests/2.18.4 setuptools/39.1.0 requests-toolbelt/0.9.1 tqdm/4.28.1 CPython/3.6.8
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
711ff8cda595923305937866abfe6c7d36b09505be7da89148ccd6c1df35112a
|
|
| MD5 |
5d5ef99b68f8c0818c707f125083c2de
|
|
| BLAKE2b-256 |
5bef354d998ab32b57f74480154aa01f1809b94e60b5ae5b0f723b6be47be09d
|