Global, local and overlap sequence alignment.
Project description
joker-aligner
Global, local and overlap sequence alignment.
from joker.aligner import get_aligner
s1 = 'MKMRGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQD'
s2 = 'MKGIKILAGGSGSSTRLYPITRGVSKQLLPVYDKPMLAGIRDILVITAPENASTTTTTT'
aligner = get_aligner('blosum62')
ali = aligner(s1, s2)
Project details
Release history Release notifications | RSS feed
Download files
Download the file for your platform. If you're not sure which to choose, learn more about installing packages.
Source Distribution
joker-aligner-0.1.tar.gz
(6.3 kB
view details)
File details
Details for the file joker-aligner-0.1.tar.gz
.
File metadata
- Download URL: joker-aligner-0.1.tar.gz
- Upload date:
- Size: 6.3 kB
- Tags: Source
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/1.13.0 pkginfo/1.5.0.1 requests/2.22.0 setuptools/41.0.1 requests-toolbelt/0.9.1 tqdm/4.32.1 CPython/3.7.4
File hashes
Algorithm | Hash digest | |
---|---|---|
SHA256 | 5c3b601fbef279bdd2e88e41f070c87e8d17c14a544677ceadc01a6c6b46f7b1 |
|
MD5 | 070cd01d4f21e84c6ee461a5263be550 |
|
BLAKE2b-256 | ed29e14356c5443b471e029c90734431bee6032c63b773e9c6a09aa649562a62 |