joker-aligner

Global, local and overlap sequence alignment.

from joker.aligner import get_aligner

s1 = 'MKMRGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQD'
s2 = 'MKGIKILAGGSGSSTRLYPITRGVSKQLLPVYDKPMLAGIRDILVITAPENASTTTTTT'

aligner = get_aligner('blosum62')
ali = aligner(s1, s2)

Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

joker-aligner-0.1.tar.gz (6.3 kB view details)

Uploaded Jan 10, 2020 Source

File details

Details for the file joker-aligner-0.1.tar.gz.

File metadata

Download URL: joker-aligner-0.1.tar.gz
Upload date: Jan 10, 2020
Size: 6.3 kB
Tags: Source
Uploaded using Trusted Publishing? No
Uploaded via: twine/1.13.0 pkginfo/1.5.0.1 requests/2.22.0 setuptools/41.0.1 requests-toolbelt/0.9.1 tqdm/4.32.1 CPython/3.7.4

File hashes

Hashes for joker-aligner-0.1.tar.gz
Algorithm	Hash digest
SHA256	`5c3b601fbef279bdd2e88e41f070c87e8d17c14a544677ceadc01a6c6b46f7b1`
MD5	`070cd01d4f21e84c6ee461a5263be550`
BLAKE2b-256	`ed29e14356c5443b471e029c90734431bee6032c63b773e9c6a09aa649562a62`