Skip to main content

Global, local and overlap sequence alignment.

Project description

joker-aligner

Global, local and overlap sequence alignment.

from joker.aligner import get_aligner

s1 = 'MKMRGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQD'
s2 = 'MKGIKILAGGSGSSTRLYPITRGVSKQLLPVYDKPMLAGIRDILVITAPENASTTTTTT'

aligner = get_aligner('blosum62')
ali = aligner(s1, s2)

Project details


Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

joker-aligner-0.1.tar.gz (6.3 kB view hashes)

Uploaded Source

Supported by

AWS AWS Cloud computing and Security Sponsor Datadog Datadog Monitoring Fastly Fastly CDN Google Google Download Analytics Microsoft Microsoft PSF Sponsor Pingdom Pingdom Monitoring Sentry Sentry Error logging StatusPage StatusPage Status page