Skip to main content

Global, local and overlap sequence alignment.

Project description

joker-aligner

Global, local and overlap sequence alignment.

from joker.aligner import get_aligner

s1 = 'MKMRGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQD'
s2 = 'MKGIKILAGGSGSSTRLYPITRGVSKQLLPVYDKPMLAGIRDILVITAPENASTTTTTT'

aligner = get_aligner('blosum62')
ali = aligner(s1, s2)

Project details


Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Files for joker-aligner, version 0.1
Filename, size File type Python version Upload date Hashes
Filename, size joker-aligner-0.1.tar.gz (6.3 kB) File type Source Python version None Upload date Hashes View

Supported by

AWS AWS Cloud computing Datadog Datadog Monitoring Facebook / Instagram Facebook / Instagram PSF Sponsor Fastly Fastly CDN Google Google Object Storage and Download Analytics Huawei Huawei PSF Sponsor Microsoft Microsoft PSF Sponsor NVIDIA NVIDIA PSF Sponsor Pingdom Pingdom Monitoring Salesforce Salesforce PSF Sponsor Sentry Sentry Error logging StatusPage StatusPage Status page