joker-aligner

Global, local and overlap sequence alignment.

from joker.aligner import get_aligner

s1 = 'MKMRGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQD'
s2 = 'MKGIKILAGGSGSSTRLYPITRGVSKQLLPVYDKPMLAGIRDILVITAPENASTTTTTT'

aligner = get_aligner('blosum62')
ali = aligner(s1, s2)

Metadata

Release files for joker-aligner 0.1

For a detailed explanation of source distributions (sdists) and built distributions (wheels), please see the package formats documentation.

Source distribution (sdist)

Source distribution for joker-aligner 0.1
File	Size	Uploaded
joker-aligner-0.1.tar.gz	6.3 kB	Jan 10, 2020	Details

Release files / joker-aligner-0.1.tar.gz

Download URL	joker-aligner-0.1.tar.gz
Size	6.3 kB
Tags	Source
SHA-256 checksum How to use checksums	`5c3b601fbef279bdd2e88e41f070c87e8d17c14a544677ceadc01a6c6b46f7b1`
BLAKE2b-256 checksum How to use checksums	`ed29e14356c5443b471e029c90734431bee6032c63b773e9c6a09aa649562a62`
Upload date	Jan 10, 2020
Uploaded using Trusted Publishing? What is trusted publishing?	No
Uploaded via	`twine/1.13.0 pkginfo/1.5.0.1 requests/2.22.0 setuptools/41.0.1 requests-toolbelt/0.9.1 tqdm/4.32.1 CPython/3.7.4`