Skip to main content

joker-aligner

Global, local and overlap sequence alignment.

from joker.aligner import get_aligner

s1 = 'MKMRGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQD'
s2 = 'MKGIKILAGGSGSSTRLYPITRGVSKQLLPVYDKPMLAGIRDILVITAPENASTTTTTT'

aligner = get_aligner('blosum62')
ali = aligner(s1, s2)

Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

joker-aligner-0.1.tar.gz (6.3 kB view details)

Uploaded Source

File details

Details for the file joker-aligner-0.1.tar.gz.

File metadata

  • Download URL: joker-aligner-0.1.tar.gz
  • Upload date:
  • Size: 6.3 kB
  • Tags: Source
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/1.13.0 pkginfo/1.5.0.1 requests/2.22.0 setuptools/41.0.1 requests-toolbelt/0.9.1 tqdm/4.32.1 CPython/3.7.4

File hashes

Hashes for joker-aligner-0.1.tar.gz
Algorithm Hash digest
SHA256 5c3b601fbef279bdd2e88e41f070c87e8d17c14a544677ceadc01a6c6b46f7b1
MD5 070cd01d4f21e84c6ee461a5263be550
BLAKE2b-256 ed29e14356c5443b471e029c90734431bee6032c63b773e9c6a09aa649562a62

See more details on using hashes here.

Release history Release notifications | RSS feed

This release

0.1 This release

1 file

0.0.2

1 file

0.0.1

1 file

Anthropic, PBC Visionary sponsor Bloomberg Visionary sponsor Hudson River Trading Visionary sponsor Meta Visionary sponsor NVIDIA Visionary sponsor Microsoft Sustainability sponsor Depot Continuous Integration AWS Cloud computing and Security Sponsor Datadog Monitoring Fastly CDN Google Download Analytics Sentry Error logging StatusPage Status page