Skip to main content

MetaLocGramN: a method for subcellular localization prediction of Gram-negative proteins.

Project description

Welcome to MetaLocGramN
---------------

The MetaLocGramN is a method for subcellular localization prediction of Gram-negative proteins.
Read more: http://iimcb.genesilico.pl/MetaLocGramN/home

How does MetaLocGramN work?
============

The MetaLocGramN is a gateway to a number of primary prediction methods (various types: signal peptide, beta-barrel, transmembrane helices and subcellular localization predictors).

The MetaLocGramN integrates the primary methods and based on their outputs provides overall consensus prediction.

Requirements
============

* suds = 0.4

Installation
============

Install it with pip (or easy_install)::

pip install MetaLocGramN

How to start?
============

If you are really lazy try:

$ ipython

In [1]: from MetaLocGramN import *
In [2]: run_example()
# job_id: 1X820N
# status: queue
# status: primary prediction::in progress
# status: primary prediction::in progress
# status: primary prediction::done
# status: consenus::done
# status: done
extracellular,47.541,0.0,0.0,0.0,52.459,
primary methods: CELLO,cytoplasmic,0.6138,0.036,0.1346,0.0612,0.1546,PSLpred,extracellular,0.2,0.531,PSORTb3,unknown,0.2,0.2,0.2,0.2,0.2,SosuiGramN,cytoplasmic
In [3]: run_example?
# to get help!
In [4]: run_example??
# to get even bigger help!

if you want to find out more, see test.py inside the pkg.

import MetaLocGramN
import time

if __name__ == "__main__":
mlgn = MetaLocGramN.MLGN()

seq = """>fasta
MKLSINKNTLESAVILCNAYVEKKDSSTITSHLFFHADEDKLLIKASDYEIGI
NYKIKKIRVESSGFATANAKSIADVIKSLNNEEVVLETIDNFLFVRQKNTKYK
"""
mlgn.predict(seq)
print '# job_id:', mlgn.get_job_id()
status = ''
while True:
status = mlgn.get_status()
print '# status:', status
if status == 'done':
break
time.sleep(5)
print mlgn.get_result()

You should get something like:

python test.py
# job_id: K6Q10Q
# status: queue
# status: queue
# status: primary prediction::in progress
# status: primary prediction::in progress
# status: primary prediction::done
# status: done
extracellular,47.541,0.0,0.0,0.0,52.459,
primary methods: CELLO,cytoplasmic,0.6138,0.036,0.1346,0.0612,0.1546,PSLpred,extracellular,0.2,0.531,PSORTb3,unknown,0.2,0.2,0.2,0.2,0.2,SosuiGramN,cytoplasmic

Authors
==================================================

Marcin Magnus,
Marcin Pawlowski,
Janusz M. Bujnicki

http://iimcb.genesilico.pl/


Happy predictions!
==================================================

Marcin Magnus magnus@genesilico.pl

Project details


Release history Release notifications | RSS feed

This version

0.99

Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

MetaLocGramN-0.99.tar.gz (14.8 kB view details)

Uploaded Source

File details

Details for the file MetaLocGramN-0.99.tar.gz.

File metadata

  • Download URL: MetaLocGramN-0.99.tar.gz
  • Upload date:
  • Size: 14.8 kB
  • Tags: Source
  • Uploaded using Trusted Publishing? No

File hashes

Hashes for MetaLocGramN-0.99.tar.gz
Algorithm Hash digest
SHA256 35bb38ad97577b5d24a3ecfef8c1cf063c38005425afc492152a2351c202a264
MD5 77128861a2060429c7593423b522de0e
BLAKE2b-256 18370a4f60aa3b1dbf71feff9814fb21baa3d1ecd613a471dd36ac5497c8c2ea

See more details on using hashes here.

Supported by

AWS AWS Cloud computing and Security Sponsor Datadog Datadog Monitoring Fastly Fastly CDN Google Google Download Analytics Microsoft Microsoft PSF Sponsor Pingdom Pingdom Monitoring Sentry Sentry Error logging StatusPage StatusPage Status page