MHC Binding Predictor
Project description
mhcflurry
MHC I ligand prediction package with competitive accuracy and a fast and documented implementation.
MHCflurry implements class I peptide/MHC binding affinity prediction. The current version provides pan-MHC I predictors supporting any MHC allele of known sequence. MHCflurry runs on Python 3.4+ using the keras neural network library. It exposes command-line and Python library interfaces.
Starting in version 1.6.0, MHCflurry also includes two expermental predictors, an “antigen processing” predictor that attempts to model MHC allele-independent effects such as proteosomal cleavage and a “presentation” predictor that integrates processing predictions with binding affinity predictions to give a composite “presentation score.” Both models are trained on mass spec-identified MHC ligands.
If you find MHCflurry useful in your research please cite:
T. O’Donnell, A. Rubinsteyn, U. Laserson. “A model of antigen processing improves prediction of MHC I-presented peptides”. biorxiv, 2020. https://www.biorxiv.org/content/10.1101/2020.03.28.013714v2
T. O’Donnell, A. Rubinsteyn, M. Bonsack, A. B. Riemer, U. Laserson, and J. Hammerbacher, “MHCflurry: Open-Source Class I MHC Binding Affinity Prediction,” Cell Systems, 2018. https://www.cell.com/cell-systems/fulltext/S2405-4712(18)30232-1.
Please file an issue if you have questions or encounter problems.
Have a bugfix or other contribution? We would love your help. See our contributing guidelines.
Installation (pip)
Install the package:
$ pip install mhcflurry
Then download our datasets and trained models:
$ mhcflurry-downloads fetch
You can now generate predictions:
$ mhcflurry-predict \ --alleles HLA-A0201 HLA-A0301 \ --peptides SIINFEKL SIINFEKD SIINFEKQ \ --out /tmp/predictions.csv Wrote: /tmp/predictions.csv
Or scan protein sequences for potential epitopes:
$ mhcflurry-predict-scan \ --sequences MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHS \ --alleles HLA-A*02:01 \ --out /tmp/predictions.csv Wrote: /tmp/predictions.csv
See the documentation for more details.
Older allele-specific models
Previous versions of MHCflurry used models trained on affinity measurements, one allele per model (i.e. allele-specific). Mass spec datasets were incorporated in the model selection step.
These models are still available to use with the latest version of MHCflurry. To download these predictors, run:
$ mhcflurry-downloads fetch models_class1
and specify --models when you call mhcflurry-predict:
$ mhcflurry-predict \ --alleles HLA-A0201 HLA-A0301 \ --peptides SIINFEKL SIINFEKD SIINFEKQ \ --models "$(mhcflurry-downloads path models_class1)/models" --out /tmp/predictions.csv Wrote: /tmp/predictions.csv
Common issues and fixes
Problems downloading data and models
Some users have reported HTTP connection issues when using mhcflurry-downloads fetch. As a workaround, you can download the data manually (e.g. using wget) and then use mhcflurry-downloads just to copy the data to the right place.
To do this, first get the URL(s) of the downloads you need using mhcflurry-downloads url:
$ mhcflurry-downloads url models_class1_presentation https://github.com/openvax/mhcflurry/releases/download/1.6.0/models_class1_presentation.20200205.tar.bz2```
Then make a directory and download the needed files to this directory:
$ mkdir downloads $ wget --directory-prefix downloads https://github.com/openvax/mhcflurry/releases/download/1.6.0/models_class1_presentation.20200205.tar.bz2``` HTTP request sent, awaiting response... 200 OK Length: 72616448 (69M) [application/octet-stream] Saving to: 'downloads/models_class1_presentation.20200205.tar.bz2'
Now call mhcflurry-downloads fetch with the --already-downloaded-dir option to indicate that the downloads should be retrived from the specified directory:
$ mhcflurry-downloads fetch models_class1_presentation --already-downloaded-dir downloads
Problems deserializing models
If you encounter errors loading the MHCflurry models, such as:
... File "/usr/local/lib/python3.6/site-packages/keras/engine/topology.py", line 293, in __init__ raise TypeError('Keyword argument not understood:', kwarg) TypeError: ('Keyword argument not understood:', 'data_format')
You may need to upgrade Keras:
pip install --upgrade Keras
Project details
Release history Release notifications | RSS feed
Download files
Download the file for your platform. If you're not sure which to choose, learn more about installing packages.
Source Distribution
Built Distribution
Hashes for mhcflurry-1.6.1-py3-none-any.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | 3b436e10b818b960b7cee903a8518454df68b8894412ab2bec9e070278945491 |
|
MD5 | 380c548b9161d5c1c70a1ec48106d952 |
|
BLAKE2b-256 | 01b8995d20a77017ac15776e3ed5b51f86addc233e37f80a5c6a0f773aca9d8d |