Python interface to running command-line and web-based MHC binding predictors
Project description
[![Build Status](https://travis-ci.org/hammerlab/mhctools.svg?branch=master)](https://travis-ci.org/hammerlab/mhctools)
# mhctools
Python interface to running command-line and web-based MHC binding predictors.
## Example
```python
from mhctools import NetMHCpan
# Run NetMHCpan for alleles HLA-A*01:01 and HLA-A*02:01
predictor = NetMHCpan(alleles=["A*02:01", "hla-a0101"])
# scan the short proteins 1L2Y and 1L3Y for epitopes
protein_sequences = {
"1L2Y": "NLYIQWLKDGGPSSGRPPPS",
"1L3Y": "ECDTINCERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQA"
}
epitope_collection = predictor.predict(protein_sequences)
# flatten binding predictions into a Pandas DataFrame
df = epitope_collection.dataframe()
# epitope collection is sorted by percentile rank
# of binding predictions
strongest_predicted_binder = epitope_collection[0]
```
## API
The following models are available in `mhctools`:
* `NetMHC`: requires locally installed version of [NetMHC](http://www.cbs.dtu.dk/services/NetMHC/)
* `NetMHCpan`: requires locally installed version of [NetMHCpan](http://www.cbs.dtu.dk/services/NetMHCpan/)
* `NetMHCIIpan`: requires locally installed version of [NetMHCIIpan](http://www.cbs.dtu.dk/services/NetMHCIIpan/)
* `NetMHCcons`: requires locally installed version of [NetMHCcons](http://www.cbs.dtu.dk/services/NetMHCcons/)
* `IedbMhcClass1`: Uses IEDB's REST API for class I binding predictions.
* `IedbMhcClass2`: Uses IEDB's REST API for class II binding predictions.
* `RandomBindingPredictor`: Creates binding predictions with random IC50 and percentile rank values.
Every model is constructed with an `alleles` argument specifying the HLA type for which to make predictions. Predictions are generated by calling the `predict` method with a dictionary mapping sequence IDs or names to amino acid sequences.
# mhctools
Python interface to running command-line and web-based MHC binding predictors.
## Example
```python
from mhctools import NetMHCpan
# Run NetMHCpan for alleles HLA-A*01:01 and HLA-A*02:01
predictor = NetMHCpan(alleles=["A*02:01", "hla-a0101"])
# scan the short proteins 1L2Y and 1L3Y for epitopes
protein_sequences = {
"1L2Y": "NLYIQWLKDGGPSSGRPPPS",
"1L3Y": "ECDTINCERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQA"
}
epitope_collection = predictor.predict(protein_sequences)
# flatten binding predictions into a Pandas DataFrame
df = epitope_collection.dataframe()
# epitope collection is sorted by percentile rank
# of binding predictions
strongest_predicted_binder = epitope_collection[0]
```
## API
The following models are available in `mhctools`:
* `NetMHC`: requires locally installed version of [NetMHC](http://www.cbs.dtu.dk/services/NetMHC/)
* `NetMHCpan`: requires locally installed version of [NetMHCpan](http://www.cbs.dtu.dk/services/NetMHCpan/)
* `NetMHCIIpan`: requires locally installed version of [NetMHCIIpan](http://www.cbs.dtu.dk/services/NetMHCIIpan/)
* `NetMHCcons`: requires locally installed version of [NetMHCcons](http://www.cbs.dtu.dk/services/NetMHCcons/)
* `IedbMhcClass1`: Uses IEDB's REST API for class I binding predictions.
* `IedbMhcClass2`: Uses IEDB's REST API for class II binding predictions.
* `RandomBindingPredictor`: Creates binding predictions with random IC50 and percentile rank values.
Every model is constructed with an `alleles` argument specifying the HLA type for which to make predictions. Predictions are generated by calling the `predict` method with a dictionary mapping sequence IDs or names to amino acid sequences.
Project details
Release history Release notifications | RSS feed
Download files
Download the file for your platform. If you're not sure which to choose, learn more about installing packages.
Source Distribution
mhctools-0.1.6.tar.gz
(24.2 kB
view hashes)