Python interface to running command-line and web-based MHC binding predictors
Project description
mhctools
Python interface to running command-line and web-based MHC binding predictors.
Example
from mhctools import NetMHCpan
# Run NetMHCpan for alleles HLA-A*01:01 and HLA-A*02:01
predictor = NetMHCpan(alleles=["A*02:01", "hla-a0101"])
# scan the short proteins 1L2Y and 1L3Y for epitopes
protein_sequences = {
"1L2Y": "NLYIQWLKDGGPSSGRPPPS",
"1L3Y": "ECDTINCERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQA"
}
epitope_collection = predictor.predict(protein_sequences)
# flatten binding predictions into a Pandas DataFrame
df = epitope_collection.dataframe()
# epitope collection is sorted by percentile rank
# of binding predictions
strongest_predicted_binder = epitope_collection[0]
API
The following models are available in mhctools: * NetMHC: requires locally installed version of NetMHC * NetMHCpan: requires locally installed version of NetMHCpan * NetMHCIIpan: requires locally installed version of NetMHCIIpan * NetMHCcons: requires locally installed version of NetMHCcons * IedbMhcClass1: Uses IEDB’s REST API for class I binding predictions. * IedbMhcClass2: Uses IEDB’s REST API for class II binding predictions. * RandomBindingPredictor: Creates binding predictions with random IC50 and percentile rank values.
Every model is constructed with an alleles argument specifying the HLA type for which to make predictions. Predictions are generated by calling the predict method with a dictionary mapping sequence IDs or names to amino acid sequences.
Project details
Release history Release notifications | RSS feed
Download files
Download the file for your platform. If you're not sure which to choose, learn more about installing packages.