Skip to main content

A Python library for pretty-printing DNA and protein sequences using a monospace font

Project description

monoseq is a Python library for pretty-printing sequence strings using a monospace font. It also provides a simple command line interface.

Sequences are pretty-printed in the for DNA and proteins traditional way using blocks of letters where each line is prefixed with the sequence position. User-specified regions are highlighted using different formatting styles. The output format can be HTML or plaintext with optional styling using ANSI escape codes for use in a terminal.

>>> import monoseq
>>> sequence = 'MIMANQPLWLDSEVEMNHYQQSHIKSKSPYFPEDKHICWIKIFKAFGT' * 4
>>> print monoseq.pprint_sequence(sequence, mode='plaintext')
  1  MIMANQPLWL DSEVEMNHYQ QSHIKSKSPY FPEDKHICWI KIFKAFGTMI MANQPLWLDS
 61  EVEMNHYQQS HIKSKSPYFP EDKHICWIKI FKAFGTMIMA NQPLWLDSEV EMNHYQQSHI
121  KSKSPYFPED KHICWIKIFK AFGTMIMANQ PLWLDSEVEM NHYQQSHIKS KSPYFPEDKH
181  ICWIKIFKAF GT

This screenshot shows the use of ANSI escape codes:

Example of formatting with ANSI escape codes

Here is an example of monoseq used to output HTML, and this IPython Notebook shows how to pretty-print sequences in an IPython Notebook.

To install the latest release via PyPI using pip:

pip install monoseq

Documentation

The latest documentation with user guide and API reference is hosted at Read The Docs.

You can also compile the documentation directly from the source code by running make html from the doc/ subdirectory. This requires Sphinx to be installed.

Project details


Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Filename, size & hash SHA256 hash help File type Python version Upload date
monoseq-1.2.1.tar.gz (8.3 kB) Copy SHA256 hash SHA256 Source None May 10, 2015

Supported by

Elastic Elastic Search Pingdom Pingdom Monitoring Google Google BigQuery Sentry Sentry Error logging AWS AWS Cloud computing DataDog DataDog Monitoring Fastly Fastly CDN SignalFx SignalFx Supporter DigiCert DigiCert EV certificate StatusPage StatusPage Status page