OpenProtein Python interface.
Project description
openprotein-python
The OpenProtein.AI Python Interface provides a user-friendly library to interact with the OpenProtein.AI REST API, enabling various tasks related to protein analysis and modeling.
Table of Contents
Workflow | Description | |
---|---|---|
0 | Quick start |
Quick start guide |
1 | Installation |
Install guide for pip and conda. |
2 | Session management |
An overview of the OpenProtein Python Client & the asynchronous jobs system. |
3 | Asssay-based Sequence Learning |
Covers core tasks such as data upload, model training & prediction, and sequence design. |
4 | De Novo prediction & generative models (PoET) |
Covers PoET, a protein LLM for de novo scoring, as well as sequence generation. |
5 | Protein Language Models & Embeddings |
Covers methods for creating sequence embeddings with proprietary & open-source models. |
Quick-start
Get started with our quickstart README! You can peruse the official documentation for more details!
Installation
To install the python interface using pip, run the following command:
pip install openprotein-python
or with conda:
conda install -c openprotein openprotein-python
Requirements
- Python 3.8 or higher.
- pydantic version 1.0 or newer.
- requests version 2.0 or newer.
- tqdm version 4.0 or newer.
- pandas version 1.0 or newer.
Getting started
Read on below for the quick-start guide, or see the docs for more information!
To begin, create a session using your login credentials.
import openprotein
# replace USERNAME and PASSWORD with your actual login credentials
session = openprotein.connect(USERNAME, PASSWORD)
Job Status
The interface offers AsyncJobFuture
objects for asynchronous calls, allowing tracking of job status and result retrieval when ready. Given a future, you can check its status and retrieve results.
Checking Job Status
Check the status of an AsyncJobFuture
using the following methods:
future.refresh() # call the backend to update the job status
future.done() # returns True if the job is done, meaning the status could be SUCCESS, FAILED, or CANCELLED
Retrieving Job Results
Once the job has finished, retrieve the results using the following methods:
result = future.wait() # wait until done and then fetch results
#verbosity is controlled with verbose arg
result = future.get(verbose=True) # get the result from a finished job
Jobs Interface
Listing Jobs
To view all jobs associated with each session, the following method is available, providing an option to filter results by date, job type, or status.
session.jobs.list()
Retrieving Specific Job
For detailed information about a particular job, use the following command with the corresponding job ID:
session.jobs.get(JOB_ID) # Replace JOB_ID with the ID of the specific job to be retrieved
Resuming Jobs
Jobs from prior workflows can be resumed using the load_job method provided by each API.
session.load_job(JOB_ID) # Replace JOB_ID with the ID of the training job to resume
PoET interface
The PoET Interface allows scoring, generating, and retrieving sequences using the PoET model.
Scoring Sequences
To score sequences, use the score function. Provide a prompt and a list of queries. The results will be a list of (sequence, score) pydantic objects.
prompt_seqs = b'MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN'
prompt = session.poet.upload_prompt(prompt_seqs)
queries = [
b'MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN',
b'MALWMRLLPLLVLLALWGPDPASAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN',
b'MALWTRLRPLLALLALWPPPPARAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREVEGPQVGALELAGGPGAGGLEGPPQKRGIVEQCCASVCSLYQLENYCN',
b'MALWIRSLPLLALLVFSGPGTSYAAANQHLCGSHLVEALYLVCGERGFFYSPKARRDVEQPLVSSPLRGEAGVLPFQQEEYEKVKRGIVEQCCHNTCSLYQLENYCN',
b'MALWMRLLPLLALLALWAPAPTRAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREVEDLQVRDVELAGAPGEGGLQPLALEGALQKRGIVEQCCTSICSLYQLENYCN',
]
future = session.poet.score(prompt, queries)
result = future.wait()
# result is a list of (sequence, score) pydantic objects
Scoring Single Site Variants
For scoring single site variants, use the single_site function
, providing the original sequence and setting prompt_is_seed
to True if the prompt is a seed sequence.
sequence = "MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN"
future = session.poet.single_site(prompt, sequence, prompt_is_seed=True)
result = future.wait()
# result is a dictionary of {variant: score}
Generating Sequences
To generate sequences from the PoET model, use the generate
function with relevant parameters. The result will be a list of generated samples.
future = session.poet.generate(
prompt,
max_seqs_from_msa=1024,
num_samples=100,
temperature=1.0,
topk=15
)
samples = future.wait()
Retrieving Input Sequences
You can retrieve the prompt, MSA, or seed sequences for a PoET job using the get_input
function or the individual functions for each type.
future.get_input(INPUT_TYPE)
# or, functions for each type
future.get_prompt()
future.get_msa()
future.get_seed()
See more at our Homepage
Project details
Release history Release notifications | RSS feed
Download files
Download the file for your platform. If you're not sure which to choose, learn more about installing packages.
Source Distribution
Built Distribution
File details
Details for the file openprotein_python-0.5.0.tar.gz
.
File metadata
- Download URL: openprotein_python-0.5.0.tar.gz
- Upload date:
- Size: 51.7 kB
- Tags: Source
- Uploaded using Trusted Publishing? No
- Uploaded via: python-httpx/0.27.2
File hashes
Algorithm | Hash digest | |
---|---|---|
SHA256 | 57beae169fb30151ed7de0d63188c46fa67e71ee28cb1c5d0caa1ffb3d314c01 |
|
MD5 | ac6a8ad163a0fbbd2157229061095f7a |
|
BLAKE2b-256 | 6af275a7c80a468a9e4c626f756b574e96a4533c49ba929318bdec8441499c81 |
File details
Details for the file openprotein_python-0.5.0-py3-none-any.whl
.
File metadata
- Download URL: openprotein_python-0.5.0-py3-none-any.whl
- Upload date:
- Size: 83.4 kB
- Tags: Python 3
- Uploaded using Trusted Publishing? No
- Uploaded via: python-httpx/0.27.2
File hashes
Algorithm | Hash digest | |
---|---|---|
SHA256 | d74d6f0e4a7f107ad84bc64f75f16db589b04b1089a368b5f07ea499fffeae12 |
|
MD5 | 462f4e0aa6f61157b1c9a1593322beef |
|
BLAKE2b-256 | 07cca42434adeae393c0670d14cadd77f71b240b1f84941bae1fd3849aa6f99e |