Introduction
PHANOTATE is a tool to annotate phage genomes. It uses the assumption that non-coding bases in a phage genome is disadvantageous, and then populates a weighted graph to find the optimal path through the six frames of the DNA where open reading frames are beneficial paths, while gaps and overlaps are penalized paths.
To install PHANOTATE,
pip3 install phanotate
or
git clone https://github.com/deprekate/PHANOTATE.git
pip3 install PHANOTATE/.
PHANOTATE Example
Run on included sample data:
phanotate.py tests/NC_001416.1.fasta
Output is the predicted ORFs, and should look like
125 187 +
191 736 +
741 2636 +
2633 2839 +
2836 4437 +
4319 5737 +
...
PHANOTATE has the ability to output different formats: genbank, gff, gff3, fasta
Output a genbank file that contains the genes and genome:
$ phanotate.py tests/phiX174.fasta -f genbank | head
LOCUS phiX174 5386 bp
FEATURES Location/Qualifiers
CDS 100..627
/note=score:-4.827981E+02
CDS 687..1622
/note=score:-4.857517E+06
CDS 1686..3227
/note=score:-3.785434E+10
CDS 3224..3484
/note=score:-3.779878E+02
Output the nucleotide bases of the gene calls in fasta format:
$ phanotate.py tests/phiX174.fasta -f fna | head -n2
>phiX174_CDS_[100..627] [note=score:-4.827981E+02]
atgtttcagacttttatttctcgccataattcaaactttttttctgataagctggttctcacttctgttactccagcttcttcggcacctgttttacagacacctaaagctacatcgtcaacgttatattttgatagtttgacggttaatgctggtaatggtggttttcttcattgcattcagatggatacatctgtcaacgccgctaatcaggttgtttctgttggtgctgatattgcttttgatgccgaccctaaattttttgcctgtttggttcgctttgagtcttcttcggttccgactaccctcccgactgcctatgatgtttatcctttgaatggtcgccatgatggtggttattataccgtcaaggactgtgtgactattgacgtccttccccgtacgccgggcaataacgtttatgttggtttcatggtttggtctaactttaccgctactaaatgccgcggattggtttcgctgaatcaggttattaaagagattatttgtctccagccacttaagtga
Output the amino-acids of the gene calls in fasta format:
$ phanotate.py tests/phiX174.fasta -f faa | head -n2
>phiX174_CDS_[100..627] [note=score:-4.827981E+02]
MFQTFISRHNSNFFSDKLVLTSVTPASSAPVLQTPKATSSTLYFDSLTVNAGNGGFLHCIQMDTSVNAANQVVSVGADIAFDADPKFFACLVRFESSSVPTTLPTAYDVYPLNGRHDGGYYTVKDCVTIDVLPRTPGNNVYVGFMVWSNFTATKCRGLVSLNQVIKEIICLQPLK*
Release files for phanotate 1.6.7
For a detailed explanation of source distributions (sdists) and built distributions (wheels), please see the package formats documentation.
Source distribution (sdist)
| File | Size | Uploaded | |
|---|---|---|---|
| phanotate-1.6.7.tar.gz | 114.3 kB | Details |
Built distribution (wheel)
| File | Interpreter | ABI | Platform | Reset |
|---|---|---|---|---|
| phanotate-1.6.7-py2.py3-none-any.whl | Python 3, Python 2 | none | any | Details |
Total release size: 145.3 kB
Release files / phanotate-1.6.7.tar.gz
| Download URL | phanotate-1.6.7.tar.gz |
|---|---|
| Size | 114.3 kB |
| Tags | Source |
|
SHA-256 checksum How to use checksums |
81889ccaa04bd530a7f2f0b93064c748940b573d736c824f2e97450df5b2033e
|
|
BLAKE2b-256 checksum How to use checksums |
f285d30456168ba839c9cd97ea241e245fef7d6cbdeaa931504c51447f0dd9a1
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
No |
| Uploaded via |
twine/4.0.2 CPython/3.9.17
|
Release files / phanotate-1.6.7-py2.py3-none-any.whl
| Download URL | phanotate-1.6.7-py2.py3-none-any.whl |
|---|---|
| Size | 31.0 kB |
| Tags | Python 2 Python 3 |
|
SHA-256 checksum How to use checksums |
f7072f5ffda3fcbfabb56329c6ae511abc5f2a86252bd0e72e6d06d6c64d00d5
|
|
BLAKE2b-256 checksum How to use checksums |
85a2d036dfd85817dae30eaf6a56ee0bfc090d2dbc46e62252b3fa61ed3c17b5
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
No |
| Uploaded via |
twine/4.0.2 CPython/3.9.17
|