Skip to main content

A a tool to annotate phage genomes

Project description

Introduction

PHANOTATE is a tool to annotate phage genomes. It uses the assumption that non-coding bases in a phage genome is disadvantageous, and then populates a weighted graph to find the optimal path through the six frames of the DNA where open reading frames are beneficial paths, while gaps and overlaps are penalized paths.

To install PHANOTATE,

pip3 install phanotate

or

 git clone https://github.com/deprekate/PHANOTATE.git
 pip3 install PHANOTATE/.

PHANOTATE Example

Run on included sample data:

phanotate.py tests/NC_001416.1.fasta 

Output is the predicted ORFs, and should look like

125     187     +
191     736     +
741     2636    +
2633    2839    +
2836    4437    +
4319    5737    +
...

PHANOTATE has the ability to output different formats: genbank, gff, gff3, fasta

Output a genbank file that contains the genes and genome:

$ phanotate.py tests/phiX174.fasta -f genbank | head 
LOCUS       phiX174                 5386 bp 
FEATURES             Location/Qualifiers
     CDS             100..627
                     /note=score:-4.827981E+02
     CDS             687..1622
                     /note=score:-4.857517E+06
     CDS             1686..3227
                     /note=score:-3.785434E+10
     CDS             3224..3484
                     /note=score:-3.779878E+02

Output the nucleotide bases of the gene calls in fasta format:

$ phanotate.py tests/phiX174.fasta -f fna | head -n2
>phiX174_CDS_[100..627] [note=score:-4.827981E+02]
atgtttcagacttttatttctcgccataattcaaactttttttctgataagctggttctcacttctgttactccagcttcttcggcacctgttttacagacacctaaagctacatcgtcaacgttatattttgatagtttgacggttaatgctggtaatggtggttttcttcattgcattcagatggatacatctgtcaacgccgctaatcaggttgtttctgttggtgctgatattgcttttgatgccgaccctaaattttttgcctgtttggttcgctttgagtcttcttcggttccgactaccctcccgactgcctatgatgtttatcctttgaatggtcgccatgatggtggttattataccgtcaaggactgtgtgactattgacgtccttccccgtacgccgggcaataacgtttatgttggtttcatggtttggtctaactttaccgctactaaatgccgcggattggtttcgctgaatcaggttattaaagagattatttgtctccagccacttaagtga

Output the amino-acids of the gene calls in fasta format:

$ phanotate.py tests/phiX174.fasta -f faa | head -n2
>phiX174_CDS_[100..627] [note=score:-4.827981E+02]
MFQTFISRHNSNFFSDKLVLTSVTPASSAPVLQTPKATSSTLYFDSLTVNAGNGGFLHCIQMDTSVNAANQVVSVGADIAFDADPKFFACLVRFESSSVPTTLPTAYDVYPLNGRHDGGYYTVKDCVTIDVLPRTPGNNVYVGFMVWSNFTATKCRGLVSLNQVIKEIICLQPLK*

Project details


Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

phanotate-1.6.6.tar.gz (114.4 kB view details)

Uploaded Source

Built Distribution

phanotate-1.6.6-py2.py3-none-any.whl (30.9 kB view details)

Uploaded Python 2 Python 3

File details

Details for the file phanotate-1.6.6.tar.gz.

File metadata

  • Download URL: phanotate-1.6.6.tar.gz
  • Upload date:
  • Size: 114.4 kB
  • Tags: Source
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/4.0.2 CPython/3.9.17

File hashes

Hashes for phanotate-1.6.6.tar.gz
Algorithm Hash digest
SHA256 ef33ec3886d9934d43e5747afc316c4229800cfce60a009fa645ff307b96e162
MD5 79fafe6a400a3e06c7d9ebe5f67f49ad
BLAKE2b-256 1b84ed61af3d7773d02c70e34b1b3512bae7e196a5cb51e30e8abb16a4099bd7

See more details on using hashes here.

File details

Details for the file phanotate-1.6.6-py2.py3-none-any.whl.

File metadata

  • Download URL: phanotate-1.6.6-py2.py3-none-any.whl
  • Upload date:
  • Size: 30.9 kB
  • Tags: Python 2, Python 3
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/4.0.2 CPython/3.9.17

File hashes

Hashes for phanotate-1.6.6-py2.py3-none-any.whl
Algorithm Hash digest
SHA256 f44f32e6adf436380751e0c9af4ca893a0b9eab53899576401c69a53cdee3ba3
MD5 26d1fd933479361b424150684ac924aa
BLAKE2b-256 30c7f67df137188a349221edeeab92f0dd8c546f656f887bff9e04ced241ae24

See more details on using hashes here.

Supported by

AWS AWS Cloud computing and Security Sponsor Datadog Datadog Monitoring Fastly Fastly CDN Google Google Download Analytics Microsoft Microsoft PSF Sponsor Pingdom Pingdom Monitoring Sentry Sentry Error logging StatusPage StatusPage Status page