Skip to main content

ProDEC

PyPI version Python versions CI License: MIT

A package to easily calculate descriptors of protein sequences and their common transforms (domain averages, auto-cross covariances, physicochemical distance transformations, and the fast Fourier transform).

Table of contents

📦 Installation

pip install prodec

Quickstart

from prodec import ProteinDescriptors, Transform, TransformType

sequence = 'MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTL'

# Load the catalog of available descriptors and pick one
pdescs = ProteinDescriptors()
zscales = pdescs.get_descriptor('Zscale Hellberg')

# Get raw per-residue descriptor values
raw_values = zscales.get(sequence)

# Apply a transform, e.g. domain averages over 5 domains
avg_zscale = Transform(TransformType.AVG, zscales)
avg_values = avg_zscale.get(sequence, domains=5)

Documentation

  • docs/usage.md — full walkthrough, gap handling, non-standard amino acids, transform compatibility, and how to add new descriptors.
  • docs/api.md — reference for ProteinDescriptors, Descriptor, Transform, and TransformType.

📖 Citation

If you use ProDEC in your work, please cite this repository:

Béquignon, O. J. M. ProDEC: a package to calculate protein sequence descriptors and their common transforms. https://github.com/OlivierBeq/ProDEC

The bundled descriptors and transforms themselves originate from the literature (e.g. Zscales by Hellberg et al., and the Raychaudhury descriptor) — see Descriptor.summary for the citation of a specific descriptor, and refer to the corresponding original publication when using it in your own research.

Contributing

Contributions are welcome — see CONTRIBUTING.md for how to set up a development environment and run the test/lint/type-check suite locally.

License

ProDEC is distributed under the MIT License.

Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

prodec-1.1.0.tar.gz (54.4 kB view details)

Uploaded Source

Built Distribution

If you're not sure about the file name format, learn more about wheel file names.

prodec-1.1.0-py3-none-any.whl (52.6 kB view details)

Uploaded Python 3

File details

Details for the file prodec-1.1.0.tar.gz.

File metadata

  • Download URL: prodec-1.1.0.tar.gz
  • Upload date:
  • Size: 54.4 kB
  • Tags: Source
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/6.1.0 CPython/3.12.3

File hashes

Hashes for prodec-1.1.0.tar.gz
Algorithm Hash digest
SHA256 05dd8094d6942218190bce2e68e006a0e59ab76643a8efd6e4a9aac49edb2113
MD5 f2a129d9f69a7b61d4360f6d7b802d78
BLAKE2b-256 3f7eb546b070f40abe84d8c6c011b7b5499be334feefa10fbb826daf5e508623

See more details on using hashes here.

File details

Details for the file prodec-1.1.0-py3-none-any.whl.

File metadata

  • Download URL: prodec-1.1.0-py3-none-any.whl
  • Upload date:
  • Size: 52.6 kB
  • Tags: Python 3
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/6.1.0 CPython/3.12.3

File hashes

Hashes for prodec-1.1.0-py3-none-any.whl
Algorithm Hash digest
SHA256 8cf7bf520ab5c79c5c9eea2914183a5eec3b601b2e1c683b69b0db85429c3071
MD5 31605f29ad577cac2c7f67adf86a7279
BLAKE2b-256 2336cb0db8317176de1fec5c66a0399eb82f5c56d582443c696e7f8509e68bff

See more details on using hashes here.

Release history Release notifications | RSS feed

This release

1.1.0 This release

2 files

1.0.2.post5

2 files

1.0.2.post4

2 files

1.0.2.post3

2 files

1.0.2.post2

2 files

1.0.2.post1

2 files

1.0.2

2 files

1.0.1.post3

2 files

1.0.1.post2

2 files

1.0.1

3 files

Anthropic, PBC Visionary sponsor Bloomberg Visionary sponsor Hudson River Trading Visionary sponsor Meta Visionary sponsor NVIDIA Visionary sponsor Microsoft Sustainability sponsor Depot Continuous Integration AWS Cloud computing and Security Sponsor Datadog Monitoring Fastly CDN Google Download Analytics Sentry Error logging StatusPage Status page