🐍🧮 PyFAMSA 
Cython bindings and Python interface to FAMSA, an algorithm for ultra-scale multiple sequence alignments.
⚠️ This package is based on FAMSA 2.
🗺️ Overview
FAMSA is a method published in 2016 by Deorowicz et al.[1] for large-scale multiple sequence alignments. It uses state-of-the-art time and memory optimizations as well as a fast guide tree heuristic to reach very high performance and accuracy.
PyFAMSA is a Python module that provides bindings to FAMSA using Cython. It implements a user-friendly, Pythonic interface to align protein sequences using different parameters and access results directly. It interacts with the FAMSA library interface, which has the following advantages:
- single dependency: PyFAMSA is distributed as a Python package, so you can add it as a dependency to your project, and stop worrying about the FAMSA binary being present on the end-user machine.
- no intermediate files: Everything happens in memory, in a Python object you control, so you don't have to invoke the FAMSA CLI using a sub-process and temporary files.
- friendly interface: The different guide tree build methods and
heuristics can be selected from the Python code with a simple keyword
argument when configuring a new
Aligner. - custom scoring matrices: You can use any custom scoring matrix from
the
scoring-matriceslibrary in addition to the default MIQS to score the alignment.
🔧 Installing
PyFAMSA can be installed directly from PyPI, which hosts some pre-built wheels for the x86-64 and Aarch architectures for Linux, MacOS and Windows, as well as the code required to compile from source with Cython:
$ pip install pyfamsa
Otherwise, PyFAMSA is also available as a Bioconda package:
$ conda install -c bioconda pyfamsa
Otherwise, have a look at the Installation page of the online documentation
💡 Example
Let's create some sequences in memory, align them using the UPGMA method, (without any heuristic), and simply print the alignment on screen:
from pyfamsa import Aligner, Sequence
sequences = [
Sequence(b"Sp8", b"GLGKVIVYGIVLGTKSDQFSNWVVWLFPWNGLQIHMMGII"),
Sequence(b"Sp10", b"DPAVLFVIMLGTITKFSSEWFFAWLGLEINMMVII"),
Sequence(b"Sp26", b"AAAAAAAAALLTYLGLFLGTDYENFAAAAANAWLGLEINMMAQI"),
Sequence(b"Sp6", b"ASGAILTLGIYLFTLCAVISVSWYLAWLGLEINMMAII"),
Sequence(b"Sp17", b"FAYTAPDLLLIGFLLKTVATFGDTWFQLWQGLDLNKMPVF"),
Sequence(b"Sp33", b"PTILNIAGLHMETDINFSLAWFQAWGGLEINKQAIL"),
]
aligner = Aligner(guide_tree="upgma")
msa = aligner.align(sequences)
for sequence in msa:
print(sequence.id.decode().ljust(10), sequence.sequence.decode())
This should output the following:
Sp10 --------DPAVLFVIMLGTIT-KFS--SEWFFAWLGLEINMMVII
Sp17 ---FAYTAPDLLLIGFLLKTVA-TFG--DTWFQLWQGLDLNKMPVF
Sp26 AAAAAAAAALLTYLGLFLGTDYENFA--AAAANAWLGLEINMMAQI
Sp33 -------PTILNIAGLHMETDI-NFS--LAWFQAWGGLEINKQAIL
Sp6 ------ASGAILTLGIYLFTLCAVIS--VSWYLAWLGLEINMMAII
Sp8 ------GLGKVIVYGIVLGTKSDQFSNWVVWLFPWNGLQIHMMGII
🧶 Thread-safety
Aligner objects are thread-safe, and the align method is re-entrant. You
could batch process several alignments in parallel using a
ThreadPool with a single
aligner object:
import glob
import multiprocessing.pool
import Bio.SeqIO
from pyfamsa import Aligner, Sequence
families = [
[ Sequence(r.id.encode(), r.seq.encode()) for r in Bio.SeqIO.parse(file, "fasta") ]
for file in glob.glob("pyfamsa/tests/data/*.faa")
]
aligner = Aligner()
with multiprocessing.pool.ThreadPool() as pool:
alignments = pool.map(aligner.align, families)
🔎 See Also
Done with your protein alignment? You may be interested in trimming it: in that
case, you could use the pytrimal Python
package, which wraps trimAl 2.0. Or perhaps
you want to build a HMM from the alignment? Then maybe have a look at
pyhmmer, a Python package which
wraps HMMER.
💭 Feedback
⚠️ Issue Tracker
Found a bug ? Have an enhancement request ? Head over to the GitHub issue tracker if you need to report or ask something. If you are filing in on a bug, please include as much information as you can about the issue, and try to recreate the same bug in a simple, easily reproducible situation.
🏗️ Contributing
Contributions are more than welcome! See
CONTRIBUTING.md
for more details.
📋 Changelog
This project adheres to Semantic Versioning and provides a changelog in the Keep a Changelog format.
⚖️ License
This library is provided under the GNU General Public License v3.0. FAMSA is developed by the
REFRESH Bioinformatics Group and is
distributed under the terms of the GPLv3 as well. See vendor/FAMSA/LICENSE
for more information. In addition, FAMSA vendors several libraries for
compatibility, all of which are redistributed with PyFAMSA under their own
terms: atomic_wait (MIT License), mimalloc (MIT License), libdeflate
(MIT License), Boost (Boost Software License).
This project is in no way not affiliated, sponsored, or otherwise endorsed by the FAMSA authors. It was developed by Martin Larralde during his PhD project at the European Molecular Biology Laboratory in the Zeller team.
📚 References
- [1] Deorowicz, Sebastian, Debudaj-Grabysz, Agnieszka & Gudyś, Adam. ‘FAMSA: Fast and accurate multiple sequence alignment of huge protein families’. Sci Rep 6, 33964 (2016). doi:10.1038/srep33964
1 maintainer
Metadata
1 maintainer
Release files for pyfamsa 0.7.0
For a detailed explanation of source distributions (sdists) and built distributions (wheels), please see the package formats documentation.
Source distribution (sdist)
| File | Size | Uploaded | |
|---|---|---|---|
| pyfamsa-0.7.0.tar.gz | 6.3 MB | Details |
Built distributions (wheels)
Total release size: 64.3 MB
Release files / pyfamsa-0.7.0.tar.gz
| Download URL | pyfamsa-0.7.0.tar.gz |
|---|---|
| Size | 6.3 MB |
| Tags | Source |
|
SHA-256 checksum How to use checksums |
5b1f3b60a319d5a5c92911cccec7ad7d506799aecac0926fecba4da370cf9b3d
|
|
BLAKE2b-256 checksum How to use checksums |
f5b149645b9e83786120fcd1c96a252dd96d73fdbede588739d4c44a970a8f3a
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.13.7
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Mar 24, 2026.
Transparency logRelease files / pyfamsa-0.7.0-pp310-pypy310_pp73-win_amd64.whl
| Download URL | pyfamsa-0.7.0-pp310-pypy310_pp73-win_amd64.whl |
|---|---|
| Size | 1.5 MB |
| Tags | PyPy 3.10 PyPy 3.10 7.3 Windows x86-64 |
|
SHA-256 checksum How to use checksums |
e37eccbb55f3375237e8eaff7309d71f8b281a23bd35475a39682b034b0776d6
|
|
BLAKE2b-256 checksum How to use checksums |
89aa0e50844f4da402ac08ef2e3bca8f7c190ded83439d5d1416c56a7a0829fa
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.13.7
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Mar 24, 2026.
Transparency logRelease files / pyfamsa-0.7.0-pp310-pypy310_pp73-manylinux_2_34_x86_64.whl
| Download URL | pyfamsa-0.7.0-pp310-pypy310_pp73-manylinux_2_34_x86_64.whl |
|---|---|
| Size | 1.9 MB |
| Tags | Linux glibc 2.34+ x86-64 PyPy 3.10 PyPy 3.10 7.3 |
|
SHA-256 checksum How to use checksums |
c254cd3025ae91e394b003d9f3d5c01ee67cc77c9dab42b37c22f7d1c01cacef
|
|
BLAKE2b-256 checksum How to use checksums |
f5ac86a48fc3e7aafece12b9ff470197ff4b4244e1cb4aece97d19b1c5154a2d
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.13.7
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Mar 24, 2026.
Transparency logRelease files / pyfamsa-0.7.0-pp310-pypy310_pp73-manylinux_2_34_aarch64.whl
| Download URL | pyfamsa-0.7.0-pp310-pypy310_pp73-manylinux_2_34_aarch64.whl |
|---|---|
| Size | 1.8 MB |
| Tags | Linux glibc 2.34+ ARM64 PyPy 3.10 PyPy 3.10 7.3 |
|
SHA-256 checksum How to use checksums |
f7339294b51a701881e8b3152fe0e2a3ed7d38805ef5bc98b70a99c9ed5ec237
|
|
BLAKE2b-256 checksum How to use checksums |
b14f4625b7120f4c12f2a49b1925f8400d76fa82b8d93358c23ede6c981ade69
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.13.7
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Mar 24, 2026.
Transparency logRelease files / pyfamsa-0.7.0-pp310-pypy310_pp73-macosx_11_0_x86_64.whl
| Download URL | pyfamsa-0.7.0-pp310-pypy310_pp73-macosx_11_0_x86_64.whl |
|---|---|
| Size | 1.6 MB |
| Tags | PyPy 3.10 PyPy 3.10 7.3 macOS 11.0+ x86-64 |
|
SHA-256 checksum How to use checksums |
8dcc8a9ee8cc7192682e50cf49c7843208506bf3bf6be533e9c989a384b34c89
|
|
BLAKE2b-256 checksum How to use checksums |
066c9aef7b0d0ec2d7f47edc6c3857427f3db82b2552e2d8d909431923d58eac
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.13.7
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Mar 24, 2026.
Transparency logRelease files / pyfamsa-0.7.0-pp310-pypy310_pp73-macosx_11_0_arm64.whl
| Download URL | pyfamsa-0.7.0-pp310-pypy310_pp73-macosx_11_0_arm64.whl |
|---|---|
| Size | 1.5 MB |
| Tags | PyPy 3.10 PyPy 3.10 7.3 macOS 11.0+ ARM64 |
|
SHA-256 checksum How to use checksums |
4c80ead59f53b1daab18dcb6dcf0c76c23a36976588414acdc57aff9f40d75c5
|
|
BLAKE2b-256 checksum How to use checksums |
791e6dac116d49a545c267b4a4b70ebd0710fe57c36ce6d4f0fe0c00da2717ac
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.13.7
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Mar 24, 2026.
Transparency logRelease files / pyfamsa-0.7.0-pp39-pypy39_pp73-win_amd64.whl
| Download URL | pyfamsa-0.7.0-pp39-pypy39_pp73-win_amd64.whl |
|---|---|
| Size | 1.5 MB |
| Tags | PyPy 3.9 PyPy 3.9 7.3 Windows x86-64 |
|
SHA-256 checksum How to use checksums |
a608faad385894d124fac4b508daeebb82a77a4dfca380783b552ad6e389d5e4
|
|
BLAKE2b-256 checksum How to use checksums |
499f93599d3e238c0f3e25a94f62bc669d66c79c953e12ce97d61bf9050ee1f8
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.13.7
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Mar 24, 2026.
Transparency logRelease files / pyfamsa-0.7.0-pp39-pypy39_pp73-manylinux_2_34_x86_64.whl
| Download URL | pyfamsa-0.7.0-pp39-pypy39_pp73-manylinux_2_34_x86_64.whl |
|---|---|
| Size | 1.9 MB |
| Tags | Linux glibc 2.34+ x86-64 PyPy 3.9 PyPy 3.9 7.3 |
|
SHA-256 checksum How to use checksums |
0d96b32601e609c0d54474d788f07a2fb584df0a32ed3dc6bed1f5585a5a4426
|
|
BLAKE2b-256 checksum How to use checksums |
d0b30781fb8f19ce5ff721e315271366f0c806835e911f6cad80cb119a73bd83
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.13.7
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Mar 24, 2026.
Transparency logRelease files / pyfamsa-0.7.0-pp39-pypy39_pp73-manylinux_2_34_aarch64.whl
| Download URL | pyfamsa-0.7.0-pp39-pypy39_pp73-manylinux_2_34_aarch64.whl |
|---|---|
| Size | 1.8 MB |
| Tags | Linux glibc 2.34+ ARM64 PyPy 3.9 PyPy 3.9 7.3 |
|
SHA-256 checksum How to use checksums |
51e3c53041008650e3087dcc06cd77b6c9fa57c58f2dc2e1ac59649015c59fe5
|
|
BLAKE2b-256 checksum How to use checksums |
c73d7787e3381665a5b03898c4ee6a56887f3f3e83a59f21e57a6f63ab1c605d
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.13.7
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Mar 24, 2026.
Transparency logRelease files / pyfamsa-0.7.0-pp39-pypy39_pp73-macosx_11_0_x86_64.whl
| Download URL | pyfamsa-0.7.0-pp39-pypy39_pp73-macosx_11_0_x86_64.whl |
|---|---|
| Size | 1.6 MB |
| Tags | PyPy 3.9 PyPy 3.9 7.3 macOS 11.0+ x86-64 |
|
SHA-256 checksum How to use checksums |
ba925111e98d9a31c7a5d7a6d2a9f72c34dabc20a529fc07e0f5f172d7c541d2
|
|
BLAKE2b-256 checksum How to use checksums |
4a1a5a67aea5cdcf4d429f2fec1ebfc18f60e9e41106b72f5e3172e7fe95c009
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.13.7
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Mar 24, 2026.
Transparency logRelease files / pyfamsa-0.7.0-pp39-pypy39_pp73-macosx_11_0_arm64.whl
| Download URL | pyfamsa-0.7.0-pp39-pypy39_pp73-macosx_11_0_arm64.whl |
|---|---|
| Size | 1.5 MB |
| Tags | PyPy 3.9 PyPy 3.9 7.3 macOS 11.0+ ARM64 |
|
SHA-256 checksum How to use checksums |
15496c8b33ac02a8f9d325037da17b931ee5747d5b21765df5ff5f003af29eab
|
|
BLAKE2b-256 checksum How to use checksums |
702f869eb7d6a4ed06e52fbaf2f66db66ba92cec3c86e792922a65aee24182e5
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.13.7
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Mar 24, 2026.
Transparency logRelease files / pyfamsa-0.7.0-pp38-pypy38_pp73-win_amd64.whl
| Download URL | pyfamsa-0.7.0-pp38-pypy38_pp73-win_amd64.whl |
|---|---|
| Size | 1.5 MB |
| Tags | PyPy 3.8 PyPy 3.8 7.3 Windows x86-64 |
|
SHA-256 checksum How to use checksums |
7d93ff0366a15d3651b2c2c7fd31b9b81d3ab647940a97a23829cfe57e594cdb
|
|
BLAKE2b-256 checksum How to use checksums |
fd0e4c51789e327eee97e5305e543a770cf9843782ac3add039ce97ba42fce07
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.13.7
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Mar 24, 2026.
Transparency logRelease files / pyfamsa-0.7.0-pp38-pypy38_pp73-manylinux_2_34_x86_64.whl
| Download URL | pyfamsa-0.7.0-pp38-pypy38_pp73-manylinux_2_34_x86_64.whl |
|---|---|
| Size | 1.9 MB |
| Tags | Linux glibc 2.34+ x86-64 PyPy 3.8 PyPy 3.8 7.3 |
|
SHA-256 checksum How to use checksums |
e9d9791344a67841c5301ebee3885507c04441d5155aacc72e14b9cb141ade9e
|
|
BLAKE2b-256 checksum How to use checksums |
6e586f12beb75aa75abf544059bd9586f79b7cbf5150fc9e557edb9f24ee0dd4
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.13.7
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Mar 24, 2026.
Transparency logRelease files / pyfamsa-0.7.0-pp38-pypy38_pp73-manylinux_2_34_aarch64.whl
| Download URL | pyfamsa-0.7.0-pp38-pypy38_pp73-manylinux_2_34_aarch64.whl |
|---|---|
| Size | 1.8 MB |
| Tags | Linux glibc 2.34+ ARM64 PyPy 3.8 PyPy 3.8 7.3 |
|
SHA-256 checksum How to use checksums |
13c9bc1f91f961411d0a6522954ca4aacd229267adefcfe0c646e10d708363a3
|
|
BLAKE2b-256 checksum How to use checksums |
f18c2cb578ae01e9477f33b23e37661cc5bcb9b1f8066ea2d9f48f815f5d1172
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.13.7
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Mar 24, 2026.
Transparency logRelease files / pyfamsa-0.7.0-pp38-pypy38_pp73-macosx_11_0_x86_64.whl
| Download URL | pyfamsa-0.7.0-pp38-pypy38_pp73-macosx_11_0_x86_64.whl |
|---|---|
| Size | 1.6 MB |
| Tags | PyPy 3.8 PyPy 3.8 7.3 macOS 11.0+ x86-64 |
|
SHA-256 checksum How to use checksums |
225b0db1762aaa819dcea85e8a5ba78ca8125e81161328ddb59375ffe1ceb685
|
|
BLAKE2b-256 checksum How to use checksums |
cdfeefabe470a90edc96a6326baf1affcba3661b7e7622b0d60807190a0567fb
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.13.7
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Mar 24, 2026.
Transparency logRelease files / pyfamsa-0.7.0-pp38-pypy38_pp73-macosx_11_0_arm64.whl
| Download URL | pyfamsa-0.7.0-pp38-pypy38_pp73-macosx_11_0_arm64.whl |
|---|---|
| Size | 1.5 MB |
| Tags | PyPy 3.8 PyPy 3.8 7.3 macOS 11.0+ ARM64 |
|
SHA-256 checksum How to use checksums |
fadae55224882f020ca86202d02e2bad736d97076c5aec09f8961ee12f76d2bc
|
|
BLAKE2b-256 checksum How to use checksums |
518c37965b181f0e02fbeb53c5b50e77414f6c82b087c933fd61921105eea928
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.13.7
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Mar 24, 2026.
Transparency logRelease files / pyfamsa-0.7.0-cp311-abi3-win_amd64.whl
| Download URL | pyfamsa-0.7.0-cp311-abi3-win_amd64.whl |
|---|---|
| Size | 1.5 MB |
| Tags | CPython 3.11 Windows x86-64 abi3 |
|
SHA-256 checksum How to use checksums |
57a62080743f2d79fbada75d45f7f70fd5f830dc331864a108db654e4edae277
|
|
BLAKE2b-256 checksum How to use checksums |
f4d641a636a69ca4c9e9407414436bbfcfb19c16523971098496abe4aaf7b520
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.13.7
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Mar 24, 2026.
Transparency logRelease files / pyfamsa-0.7.0-cp311-abi3-manylinux_2_34_x86_64.whl
| Download URL | pyfamsa-0.7.0-cp311-abi3-manylinux_2_34_x86_64.whl |
|---|---|
| Size | 1.9 MB |
| Tags | CPython 3.11 Linux glibc 2.34+ x86-64 abi3 |
|
SHA-256 checksum How to use checksums |
16b65d55d32efb46034973cba9c22b1567648fa7a1094ebfff569065dac06912
|
|
BLAKE2b-256 checksum How to use checksums |
66f76bed41f28ceb39bb941b7709407cef547d87ccd2492bb9ed0113869230b0
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.13.7
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Mar 24, 2026.
Transparency logRelease files / pyfamsa-0.7.0-cp311-abi3-manylinux_2_34_aarch64.whl
| Download URL | pyfamsa-0.7.0-cp311-abi3-manylinux_2_34_aarch64.whl |
|---|---|
| Size | 1.8 MB |
| Tags | CPython 3.11 Linux glibc 2.34+ ARM64 abi3 |
|
SHA-256 checksum How to use checksums |
cf33d88cfebe49de6ab4683499455d6d40103c0e0ad801f8789514fcc1dc7489
|
|
BLAKE2b-256 checksum How to use checksums |
f328e8f5cb9450299eb69f7c5856dd2c896a938b0de2d0e5223da47b84a0477f
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.13.7
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Mar 24, 2026.
Transparency logRelease files / pyfamsa-0.7.0-cp311-abi3-macosx_11_0_x86_64.whl
| Download URL | pyfamsa-0.7.0-cp311-abi3-macosx_11_0_x86_64.whl |
|---|---|
| Size | 1.6 MB |
| Tags | CPython 3.11 abi3 macOS 11.0+ x86-64 |
|
SHA-256 checksum How to use checksums |
f05c259b1ff60d531b8a41150f233a567363df082a072a5e67df0239da7b7e62
|
|
BLAKE2b-256 checksum How to use checksums |
6ae89694c57dd1d27a61ec1d10455937ba3438b724f0bde01f6c80a34b1ed251
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.13.7
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Mar 24, 2026.
Transparency logRelease files / pyfamsa-0.7.0-cp311-abi3-macosx_11_0_arm64.whl
| Download URL | pyfamsa-0.7.0-cp311-abi3-macosx_11_0_arm64.whl |
|---|---|
| Size | 1.5 MB |
| Tags | CPython 3.11 abi3 macOS 11.0+ ARM64 |
|
SHA-256 checksum How to use checksums |
a81feab50abd959068ae88aa2a88106fabf0ae368d76bb7ddec1d53d11f8b2bf
|
|
BLAKE2b-256 checksum How to use checksums |
3f017a70c5c3706d42775f13ad221ba45b940b895383594b1932737d7d63360c
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.13.7
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Mar 24, 2026.
Transparency logRelease files / pyfamsa-0.7.0-cp310-cp310-win_amd64.whl
| Download URL | pyfamsa-0.7.0-cp310-cp310-win_amd64.whl |
|---|---|
| Size | 1.5 MB |
| Tags | CPython 3.10 Windows x86-64 |
|
SHA-256 checksum How to use checksums |
dbfec3437a729bdb3fd46270a5c51f7861d9ec87bddd6da5f609d8350843d913
|
|
BLAKE2b-256 checksum How to use checksums |
e309875fa5f86dcd8d512a3f0a2f0a744179d608dcd328d971c72d6d9336d0be
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.13.7
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Mar 24, 2026.
Transparency logRelease files / pyfamsa-0.7.0-cp310-cp310-manylinux_2_34_x86_64.whl
| Download URL | pyfamsa-0.7.0-cp310-cp310-manylinux_2_34_x86_64.whl |
|---|---|
| Size | 1.9 MB |
| Tags | CPython 3.10 Linux glibc 2.34+ x86-64 |
|
SHA-256 checksum How to use checksums |
3215cf7b4688194cf7710495401ab867aeb49aba11c98eeca828aab72a5b9796
|
|
BLAKE2b-256 checksum How to use checksums |
58386fe1c7ef52dcbb4f2abb6636a4aaecc2c1df157109158220d00a0a9d2c01
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.13.7
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Mar 24, 2026.
Transparency logRelease files / pyfamsa-0.7.0-cp310-cp310-manylinux_2_34_aarch64.whl
| Download URL | pyfamsa-0.7.0-cp310-cp310-manylinux_2_34_aarch64.whl |
|---|---|
| Size | 1.8 MB |
| Tags | CPython 3.10 Linux glibc 2.34+ ARM64 |
|
SHA-256 checksum How to use checksums |
3982877bcc1cde5c23f0ae8b22919c18e54b2a03d35da5567624bdebc709d493
|
|
BLAKE2b-256 checksum How to use checksums |
b91dfed4d92a1c946fee7690d8b7fc15c784eadc32a9dc8552545635f8852754
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.13.7
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Mar 24, 2026.
Transparency logRelease files / pyfamsa-0.7.0-cp310-cp310-macosx_11_0_x86_64.whl
| Download URL | pyfamsa-0.7.0-cp310-cp310-macosx_11_0_x86_64.whl |
|---|---|
| Size | 1.6 MB |
| Tags | CPython 3.10 macOS 11.0+ x86-64 |
|
SHA-256 checksum How to use checksums |
be4221b3482e120566a00fd738af3f326ee0849025c355a7a9685225e1a4b08f
|
|
BLAKE2b-256 checksum How to use checksums |
4a5082d62c7ee07d57ab9833f49bc4bfcad28a996ad294202f3b58c3689da596
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.13.7
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Mar 24, 2026.
Transparency logRelease files / pyfamsa-0.7.0-cp310-cp310-macosx_11_0_arm64.whl
| Download URL | pyfamsa-0.7.0-cp310-cp310-macosx_11_0_arm64.whl |
|---|---|
| Size | 1.5 MB |
| Tags | CPython 3.10 macOS 11.0+ ARM64 |
|
SHA-256 checksum How to use checksums |
3d3dc7c2b983bac55f4ab0441be79bcf3b201e02acda852bd83c8ae322833573
|
|
BLAKE2b-256 checksum How to use checksums |
39e9597bc5791ecd65c24e84009e82f86b88fbd822357b99655f85b153f71c46
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.13.7
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Mar 24, 2026.
Transparency logRelease files / pyfamsa-0.7.0-cp39-cp39-win_amd64.whl
| Download URL | pyfamsa-0.7.0-cp39-cp39-win_amd64.whl |
|---|---|
| Size | 1.5 MB |
| Tags | CPython 3.9 Windows x86-64 |
|
SHA-256 checksum How to use checksums |
52f1674b160046b3981941b5f89d404cdb6e63469a3f871db71598e4df418380
|
|
BLAKE2b-256 checksum How to use checksums |
ce0d4e01bd43efc0d528d54c8300d2bb3264335d68e295087ee87ccc0b679819
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.13.7
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Mar 24, 2026.
Transparency logRelease files / pyfamsa-0.7.0-cp39-cp39-manylinux_2_34_x86_64.whl
| Download URL | pyfamsa-0.7.0-cp39-cp39-manylinux_2_34_x86_64.whl |
|---|---|
| Size | 1.9 MB |
| Tags | CPython 3.9 Linux glibc 2.34+ x86-64 |
|
SHA-256 checksum How to use checksums |
54c65f1fabff27e09ed2fc1087c41bf40c601c84eec7b9ebeb3f3f51dd1e9e1e
|
|
BLAKE2b-256 checksum How to use checksums |
756d76e57d203f3da8c56681a70a319b631cdcfc81248d056b776840b938a746
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.13.7
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Mar 24, 2026.
Transparency logRelease files / pyfamsa-0.7.0-cp39-cp39-manylinux_2_34_aarch64.whl
| Download URL | pyfamsa-0.7.0-cp39-cp39-manylinux_2_34_aarch64.whl |
|---|---|
| Size | 1.8 MB |
| Tags | CPython 3.9 Linux glibc 2.34+ ARM64 |
|
SHA-256 checksum How to use checksums |
01989d6b02a42183db301ea5f9e99c1601c6b71320d8bae83bed84018c7ae36d
|
|
BLAKE2b-256 checksum How to use checksums |
3c5153be5f6340ded5602f58e283e37e6a6aa7081541dfbffc1bb269c386aae0
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.13.7
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Mar 24, 2026.
Transparency logRelease files / pyfamsa-0.7.0-cp39-cp39-macosx_11_0_x86_64.whl
| Download URL | pyfamsa-0.7.0-cp39-cp39-macosx_11_0_x86_64.whl |
|---|---|
| Size | 1.6 MB |
| Tags | CPython 3.9 macOS 11.0+ x86-64 |
|
SHA-256 checksum How to use checksums |
2a263c750c9bbe441ea572d0ec957f407f6daae8215ad3b694c70037d8562476
|
|
BLAKE2b-256 checksum How to use checksums |
a7c826038ced19e160d6f80e01211bde3fe7c76dfc0a5a269bcbf5934127b278
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.13.7
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Mar 24, 2026.
Transparency logRelease files / pyfamsa-0.7.0-cp39-cp39-macosx_11_0_arm64.whl
| Download URL | pyfamsa-0.7.0-cp39-cp39-macosx_11_0_arm64.whl |
|---|---|
| Size | 1.5 MB |
| Tags | CPython 3.9 macOS 11.0+ ARM64 |
|
SHA-256 checksum How to use checksums |
af764c41d130ce1eb539a6145571e55a7f0fbd635038c7f46aa4b36729aadd1b
|
|
BLAKE2b-256 checksum How to use checksums |
f4a4182e8ee6024aeab99f29589d687493e0947573e998dd5afdef9f18471676
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.13.7
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Mar 24, 2026.
Transparency logRelease files / pyfamsa-0.7.0-cp38-cp38-win_amd64.whl
| Download URL | pyfamsa-0.7.0-cp38-cp38-win_amd64.whl |
|---|---|
| Size | 1.5 MB |
| Tags | CPython 3.8 Windows x86-64 |
|
SHA-256 checksum How to use checksums |
2a6214709b9e9eaccbbf1b864a0fb5ecbf7ab45d6f1fcd695d8cacf01203ea82
|
|
BLAKE2b-256 checksum How to use checksums |
9ce92c6823c09420fc84676c869af49308d3aded52a92c182297aad991b93430
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.13.7
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Mar 24, 2026.
Transparency logRelease files / pyfamsa-0.7.0-cp38-cp38-manylinux_2_34_x86_64.whl
| Download URL | pyfamsa-0.7.0-cp38-cp38-manylinux_2_34_x86_64.whl |
|---|---|
| Size | 1.9 MB |
| Tags | CPython 3.8 Linux glibc 2.34+ x86-64 |
|
SHA-256 checksum How to use checksums |
6d003f783cb25f774c595c382739364c5e209f857b1d78255b94b3be3b401bf1
|
|
BLAKE2b-256 checksum How to use checksums |
551e6c98b87d545f2f0382998210250455b011a9f87ddb13c8af67890b8f4b69
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.13.7
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Mar 24, 2026.
Transparency logRelease files / pyfamsa-0.7.0-cp38-cp38-manylinux_2_34_aarch64.whl
| Download URL | pyfamsa-0.7.0-cp38-cp38-manylinux_2_34_aarch64.whl |
|---|---|
| Size | 1.8 MB |
| Tags | CPython 3.8 Linux glibc 2.34+ ARM64 |
|
SHA-256 checksum How to use checksums |
c204f851009536241aecccf32c2e53b7a7af840d0ea1b33bd37e83ed30980fae
|
|
BLAKE2b-256 checksum How to use checksums |
51813aa4b5381b13b99f3a7b5afe23f2b77817ed3535dcea03d364fcaa86ef9e
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.13.7
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Mar 24, 2026.
Transparency logRelease files / pyfamsa-0.7.0-cp38-cp38-macosx_11_0_x86_64.whl
| Download URL | pyfamsa-0.7.0-cp38-cp38-macosx_11_0_x86_64.whl |
|---|---|
| Size | 1.6 MB |
| Tags | CPython 3.8 macOS 11.0+ x86-64 |
|
SHA-256 checksum How to use checksums |
20e5b1f407e23296c12aefd4e741109ce8732e384f5235ed67f71efc63f8a30d
|
|
BLAKE2b-256 checksum How to use checksums |
75a3aaf8de411c083cd9cbbe0da2a3640d829754f06022217f354797396839df
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.13.7
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Mar 24, 2026.
Transparency logRelease files / pyfamsa-0.7.0-cp38-cp38-macosx_11_0_arm64.whl
| Download URL | pyfamsa-0.7.0-cp38-cp38-macosx_11_0_arm64.whl |
|---|---|
| Size | 1.5 MB |
| Tags | CPython 3.8 macOS 11.0+ ARM64 |
|
SHA-256 checksum How to use checksums |
1f25238920edc560b68d5b0c9596accb08dea64ddb1b7cbf865a07aff765271d
|
|
BLAKE2b-256 checksum How to use checksums |
eb6534a8356dfd2326c9fb31af786c0c0426d4738d1a1604798d68837866d5f5
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.13.7
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Mar 24, 2026.
Transparency log
