Cython bindings and Python interface to FAMSA, an algorithm for ultra-scale multiple sequence alignments.
Project description
🐍🧮 pyfamsa ![Stars](https://pypi-camo.freetls.fastly.net/93abec8133deee2a69250e094383262f65f456ca/68747470733a2f2f696d672e736869656c64732e696f2f6769746875622f73746172732f616c74686f6e6f732f707966616d73612e7376673f7374796c653d736f6369616c266d61784167653d33363030266c6162656c3d53746172)
Cython bindings and Python interface to FAMSA, an algorithm for ultra-scale multiple sequence alignments.
⚠️ This package is based on FAMSA 2.
🗺️ Overview
pyfamsa is a Python module that provides bindings to FAMSA using Cython. It implements a user-friendly, Pythonic interface to align protein sequences using different parameters and access results directly. It interacts with the FAMSA library interface, which has the following advantages:
- single dependency: pyfamsa is distributed as a Python package, so you can add it as a dependency to your project, and stop worrying about the FAMSA binary being present on the end-user machine.
- no intermediate files: Everything happens in memory, in a Python object you control, so you don't have to invoke the FAMSA CLI using a sub-process and temporary files.
- friendly interface: The different guide tree build methods and
heuristics can be selected from the Python code with a simple keyword
argument when configuring a new
Aligner
.
🔧 Installing
pyfamsa can be installed directly from PyPI, which hosts some pre-built wheels for the x86-64 architecture (Linux/OSX) and the Aarch64 architecture (Linux only), as well as the code required to compile from source with Cython:
$ pip install pyfamsa
💡 Example
Let's create some sequences in memory, align them using the UPGMA method, (without any heuristic), and simply print the alignment on screen:
from pyfamsa import Aligner, Sequence
sequences = [
Sequence(b"Sp8", b"GLGKVIVYGIVLGTKSDQFSNWVVWLFPWNGLQIHMMGII"),
Sequence(b"Sp10", b"DPAVLFVIMLGTITKFSSEWFFAWLGLEINMMVII"),
Sequence(b"Sp26", b"AAAAAAAAALLTYLGLFLGTDYENFAAAAANAWLGLEINMMAQI"),
Sequence(b"Sp6", b"ASGAILTLGIYLFTLCAVISVSWYLAWLGLEINMMAII"),
Sequence(b"Sp17", b"FAYTAPDLLLIGFLLKTVATFGDTWFQLWQGLDLNKMPVF"),
Sequence(b"Sp33", b"PTILNIAGLHMETDINFSLAWFQAWGGLEINKQAIL"),
]
aligner = Aligner(guide_tree="upgma")
msa = aligner.align(sequences)
for sequence in msa:
print(sequence.id.decode().ljust(10), sequence.sequence.decode())
This should output the following:
Sp10 --------DPAVLFVIMLGTIT-KFS--SEWFFAWLGLEINMMVII
Sp17 ---FAYTAPDLLLIGFLLKTVA-TFG--DTWFQLWQGLDLNKMPVF
Sp26 AAAAAAAAALLTYLGLFLGTDYENFA--AAAANAWLGLEINMMAQI
Sp33 -------PTILNIAGLHMETDI-NFS--LAWFQAWGGLEINKQAIL
Sp6 ------ASGAILTLGIYLFTLCAVIS--VSWYLAWLGLEINMMAII
Sp8 ------GLGKVIVYGIVLGTKSDQFSNWVVWLFPWNGLQIHMMGII
🧶 Thread-safety
Aligner
objects are thread-safe, and the align
method is re-entrant. You
could batch process several alignments in parallel using a
ThreadPool
with a single
aligner object:
import glob
import multiprocessing.pool
import Bio.SeqIO
from pyfamsa import Aligner, Sequence
families = [
[ Sequence(r.id.encode(), r.seq.encode()) for r in Bio.SeqIO.parse(file, "fasta") ]
for file in glob.glob("pyfamsa/tests/data/*.faa")
]
aligner = Aligner()
with multiprocessing.pool.ThreadPool() as pool:
alignments = pool.map(aligner.align, families)
🔎 See Also
Done with your protein alignment? You may be interested in trimming it: in that
case, you could use the pytrimal
Python
package, which wraps trimAl 2.0. Or perhaps
you want to build a HMM from the alignment? Then maybe have a look at
pyhmmer
, a Python package which
wraps HMMER.
💭 Feedback
⚠️ Issue Tracker
Found a bug ? Have an enhancement request ? Head over to the GitHub issue tracker if you need to report or ask something. If you are filing in on a bug, please include as much information as you can about the issue, and try to recreate the same bug in a simple, easily reproducible situation.
🏗️ Contributing
Contributions are more than welcome! See
CONTRIBUTING.md
for more details.
📋 Changelog
This project adheres to Semantic Versioning and provides a changelog in the Keep a Changelog format.
⚖️ License
This library is provided under the GNU General Public License v3.0.
FAMSA is developed by the REFRESH Bioinformatics Group and is distributed under the
terms of the GPLv3 as well. See vendor/FAMSA/LICENSE
for more information.
This project is in no way not affiliated, sponsored, or otherwise endorsed by the FAMSA authors. It was developed by Martin Larralde during his PhD project at the European Molecular Biology Laboratory in the Zeller team.
Project details
Download files
Download the file for your platform. If you're not sure which to choose, learn more about installing packages.
Source Distribution
Built Distributions
Hashes for pyfamsa-0.1.0-pp39-pypy39_pp73-macosx_10_9_x86_64.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | c305e69d0b568c68cb4c24557d2316ecac159f2aadd26d95bf551e4a02e45cf9 |
|
MD5 | 9ffda160dd5eaee1f2a55d9f5e84baba |
|
BLAKE2b-256 | 2c2929ec3ddc0f8f68cca0a1422e64ad286d16500c1c0c285f4cb0429ce421c7 |
Hashes for pyfamsa-0.1.0-pp38-pypy38_pp73-macosx_10_9_x86_64.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | 70fef6ef4bbb15e8a3d397232504330ee20224451309b88b8229a8b5181176a4 |
|
MD5 | bbc955e0150e48395899f8588e7e1437 |
|
BLAKE2b-256 | 87dbdd77f4ce63c87e0dbec7449bbb56150ba14fe96e4678802be91890dcfd5e |
Hashes for pyfamsa-0.1.0-pp37-pypy37_pp73-manylinux_2_12_x86_64.manylinux2010_x86_64.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | e3e9fe99487e28ba8f403391b5d28b01d56a11c04ed4289f5b3771401a069d17 |
|
MD5 | 004bf4aed0159aa54651eb3448d44cc0 |
|
BLAKE2b-256 | b63febab349199bf3a90d0bfc0b3c7bc3b58100cd73e6310e1018cddf547441b |
Hashes for pyfamsa-0.1.0-pp37-pypy37_pp73-macosx_10_9_x86_64.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | 7dbcbea36604261f9326d00d712394884b21a5c32d8f13bb9b70d090e03fe265 |
|
MD5 | 80925c08ed50eaa62ccc501acde73650 |
|
BLAKE2b-256 | b1cf912e05c8238ca3b55953b34ed25aa1d3e22fdf8d084db9a3af788da0e2c5 |
Hashes for pyfamsa-0.1.0-pp36-pypy36_pp73-manylinux_2_12_x86_64.manylinux2010_x86_64.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | 28362383c0cb70df3d2452e2382eaaec0793ee8f6184a93e6296a8990da6f7c7 |
|
MD5 | bcef8b5a5261d2663f076d8bc6b05441 |
|
BLAKE2b-256 | 272a47c0b11d5bab0573ed220c3395ad46f13c04867388fccb66b340c025a5d1 |
Hashes for pyfamsa-0.1.0-cp310-cp310-manylinux_2_17_aarch64.manylinux2014_aarch64.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | 2715573586b445164e65918ef85277082a5947ce49cee7f89dd39068dfeb3bb9 |
|
MD5 | bb03339c6d666936dbdd2474dc92908d |
|
BLAKE2b-256 | 0fdbe9d21cd36edf59ee66231808b213518d1541a9a18ac806be17dbab33069c |
Hashes for pyfamsa-0.1.0-cp310-cp310-manylinux_2_12_x86_64.manylinux2010_x86_64.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | 5bcbabcb729098ed276eb7b8a93d68994ef55ad82688472dac09ed5a2d4c6d1a |
|
MD5 | 5ca43d437c391edc9944237fba436627 |
|
BLAKE2b-256 | c708f53ce1dfc080a39e8dfdea600dcbdcc3171dd9e2a24f02080ed5f546ca8b |
Hashes for pyfamsa-0.1.0-cp310-cp310-macosx_10_15_x86_64.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | f2c5c703f11643cdfdf59f7881e87ece7294b395054a35d485089951b0e84286 |
|
MD5 | 2fc066953d45f4719fcbecc352330c05 |
|
BLAKE2b-256 | 1f06353c165668c613e1c660e1d21bab611d056ba7fd61e064ca7db260a31537 |
Hashes for pyfamsa-0.1.0-cp39-cp39-manylinux_2_17_aarch64.manylinux2014_aarch64.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | b04745429cb6457653fbe8285953e74ea96a5fda988076a529807562c7081e4a |
|
MD5 | 740b083a0a9a409cfa4f17adb71738d7 |
|
BLAKE2b-256 | 10106296f4f4a81813fedac21048c7bf48f227672aa31900837ac7d567939acf |
Hashes for pyfamsa-0.1.0-cp39-cp39-manylinux_2_12_x86_64.manylinux2010_x86_64.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | d46ec71161c653302492ce3ad468eaba3c900cc5123f76c66f376a496b535690 |
|
MD5 | 5ff2db398cfcd485f26645e6310b5adb |
|
BLAKE2b-256 | b2a7ad2f577aace1e5029176a589bbd74d66f27dc61bc670661b5815c6be4f86 |
Hashes for pyfamsa-0.1.0-cp39-cp39-macosx_10_15_x86_64.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | 2a0bb54b286cd80ccde178ce62f4c52662928873071bf785eb0d0186998965b0 |
|
MD5 | 0fc22ec9bc9f16e4f1a24c6c5d33442d |
|
BLAKE2b-256 | 87caa2c469e34044fe370a7e99e95240199bb0bde51c7ffeb559cfd389695368 |
Hashes for pyfamsa-0.1.0-cp38-cp38-manylinux_2_17_aarch64.manylinux2014_aarch64.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | 13a6dc66760b0b7da04249fdc24fd224499b401413a5ee255ee369b99cdb3c59 |
|
MD5 | 3515e0cee01cff2fdfc9f5f513bca660 |
|
BLAKE2b-256 | 827894b78557e91c1a95f1fac3c956b59cc630f963b2f10e503db0afab843606 |
Hashes for pyfamsa-0.1.0-cp38-cp38-manylinux_2_12_x86_64.manylinux2010_x86_64.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | ef46391bc8ef9d368f08da7e450568da13d56538d20b848ed47acf469bde50a8 |
|
MD5 | 4a59ed28df1a951ece116bff3c8c9836 |
|
BLAKE2b-256 | 7b0fe714b32d2acd60e3dcd8d7726edf6e2f01caec2f8ba6c1998255683c538c |
Hashes for pyfamsa-0.1.0-cp38-cp38-macosx_10_15_x86_64.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | beb598eeb78ec433c9fbe4cbc604d8ba6d3c3f26251c6ebb3242cb991c0049a2 |
|
MD5 | 196420abe4e56dd9b338357bdf84ea37 |
|
BLAKE2b-256 | 00d9f0f8f07417ab4d593fcbb282bfc25abbb9b8ac9c137859ec4f8765fdeac7 |
Hashes for pyfamsa-0.1.0-cp37-cp37m-manylinux_2_17_aarch64.manylinux2014_aarch64.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | 1daaa990cf694b68157cd07244f63ec9e90640e90a5e9acc1335bdbd745f6fdf |
|
MD5 | bc87362a58d93cb5a0344fa68e7a499e |
|
BLAKE2b-256 | 336d5006a79e689b4ad79937a5536c25722c1b7d13b5cdf6465b4b1a1db26f46 |
Hashes for pyfamsa-0.1.0-cp37-cp37m-manylinux_2_12_x86_64.manylinux2010_x86_64.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | fc660e3ae2344fbd5784397748700752b5eb98aa6ddb3d21a757d3c4728ebd59 |
|
MD5 | cd1c1d605c4626b64c11011b5d3c2dd8 |
|
BLAKE2b-256 | 359df6fe5dec78ee28c29eb8d050854b574949310cbe3daf09d02e6c010d3d7e |
Hashes for pyfamsa-0.1.0-cp37-cp37m-macosx_10_15_x86_64.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | a0cb049196dae434278e1eff8d604254e22e3bebd2ef6208a726547fa70b2d51 |
|
MD5 | 2f099c95ef28949dc9598ebedea23176 |
|
BLAKE2b-256 | 272d91428e25389625798ee09599c54c516c4d2b225d78c63b2f8b49600f4f33 |
Hashes for pyfamsa-0.1.0-cp36-cp36m-manylinux_2_17_aarch64.manylinux2014_aarch64.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | bb109189568f4e84327ff91df10832334cded734319d00e8a85cb86684e96d59 |
|
MD5 | 4c64f4cd00d437dcc214dad1a557cabd |
|
BLAKE2b-256 | 78498e9ad59ed54e7542740904595eefbcb584bb9d133d399bf394334563918e |
Hashes for pyfamsa-0.1.0-cp36-cp36m-manylinux_2_12_x86_64.manylinux2010_x86_64.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | 4ba40be63a36f05cb1021897c923d98aff35443517043e81e9cf72007e8dd9c9 |
|
MD5 | 1bc75f14061a2bb321e999774413378e |
|
BLAKE2b-256 | 3b4d69bdae4a99c04e627dc42f0f5db33906f8be3c3f1bf9aa370e4ad7b7719c |
Hashes for pyfamsa-0.1.0-cp36-cp36m-macosx_10_14_x86_64.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | 79f37ef8cdfd3851750e350731e61c94b3d55610855fb3030b050eb80e6375f5 |
|
MD5 | b6b6276b44249368965ba18172aff2fb |
|
BLAKE2b-256 | 9f35f5c5f100d09f63a095e1fdff9f4b0483f9bc9b1776fab288b9dc584f13d6 |
Hashes for pyfamsa-0.1.0-cp35-cp35m-manylinux2010_x86_64.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | 5b6b117dc443f6b3b254899e99904e6abcf6ee1e1e4cbf564297dbb585b4511a |
|
MD5 | 4bc63ba59e68506433f278e106e28350 |
|
BLAKE2b-256 | 711a2df1d05f8349dbdbdf0665ea424a9a442dfa954044d70fb75698fe2e7e90 |
Hashes for pyfamsa-0.1.0-cp35-cp35m-macosx_10_14_x86_64.whl
Algorithm | Hash digest | |
---|---|---|
SHA256 | f94de39d83d68b7e3804fd163b9e0a63ffabdcf63d2c745fac792303ba7cd34d |
|
MD5 | b09cf0da3c260ea1954dbeaf0be90ece |
|
BLAKE2b-256 | 9fdfe481b99aafec18b0d39f2ba5490b0975da5f7fbdfabd18132ea903e10f84 |