Skip to main content

Build Status License PyPI version

ff3 - Format Preserving Encryption in Python

An implementation of the NIST approved Format Preserving Encryption (FPE) FF3 algorithm in Python.

This package follows the FF3 algorithum for Format Preserving Encryption as described in the March 2016 NIST publication Methods for Format-Preserving Encryption, and revised on Feburary 28th, 2020 with a draft update for FF3-1.

Changes to minimum domain size and revised tweak length have been implemented in this package. Tweaks can be 56 or 64 bits, but NIST has only published test vectors for 64-bit tweaks. It is expected the final standard will provide updated test vectors necessary to change the tweak lengths to 56 bits.

Requires

This project was built and tested with Python 3.6 and later versions. It requires the pycryptodome library:

pip3 install pycryptodome

Installation

Install this project with pip:

pip3 install pyFPE

Usage

FF3 is a Feistel cipher, and Feistel ciphers are initialized with a radix representing an alphabet.
Practial radix limits of 36 in python means the following radix values are typical:

  • radix 10: digits 0..9
  • radix 36: alphanumeric 0..9, a-z
  • radix 64: alphanumeric 0..9, a-z, A-Z, '-

Special characters and international character sets, such as those found in UTF-8, would require a larger radix, and are not supported. Also, all elements in a plaintext string share the same radix. Thus, an identification number that consists of a letter followed by 6 digits (e.g. A123456) cannot be correctly encrypted by FPE while preserving this convention.

Input plaintext has maximum length restrictions based upon the chosen radix (2 * floor(96/log2(radix))):

  • radix 10: 56
  • radix 36: 36
  • radix 64: 32

To work around string length, its possible to encode longer text in chunks before and after encryption. As transparent chunking feature has been added, such pre-processing for chunking is not required, but a developer can achieve greater control on chunk-size.

As with any cryptographic package, managing and protecting the key(s) is crucial. The tweak is generally not kept secret. This package does not protect the key in memory.

Code Example

The example code below uses the default domain [0-9] and can help you get started.

from pyfpe_ff3 import FF3Cipher

key = "EF4359D8D580AA4F7F036D6F04FC6A94"
tweak = "D8E7920AFA330A73"
c = FF3Cipher(key, tweak)

plaintext = "4000001234567899"
ciphertext = c.encrypt(plaintext)
decrypted = c.decrypt(ciphertext)

print(f"{plaintext} -> {ciphertext} -> {decrypted}")

# format encrypted value
ccn = f"{ciphertext[:4]} {ciphertext[4:8]} {ciphertext[8:12]} {ciphertext[12:]}"
print(f"Encrypted CCN value with formatting: {ccn}")

The example code below uses the default domain [0-9] to anonymize US SSN by scrubbing non-digit characters and reformat the final result. It can be applied for Phone Numbers as well.

from pyfpe_ff3 import FF3Cipher, format_align_digits
key = "EF4359D8D580AA4F7F036D6F04FC6A94"
tweak = "D8E7920AFA330A73"
c = FF3Cipher(key, tweak)
actual_ssn = "845-06-9423"
anonymized_ssn = format_align_digits(c.encrypt(actual_ssn),actual_ssn)
print(f"{actual_ssn} -> {anonymized_ssn}")

Following example shows transparent chunking for length limit ( say 32 chaacters for radix 64). This way we can handle larger plaintext to cipher and decipher.

from pyfpe_ff3 import FF3Cipher

key = "EF4359D8D580AA4F7F036D6F04FC6A94"
tweak = "A8E7920AFA330A73"
c = FF3Cipher(key, tweak, radix=64, allow_small_domain= True)
plaintext = "Donaudampfschifffahrtsgesellschaftskapitaenswitwe"*2  # 49x2 =98 characters
ciphertext = c.encrypt(plaintext)
decrypted = c.decrypt(ciphertext)
print(f"{plaintext} -> \n{ciphertext} -> \n{decrypted}")

Testing

There are official test vectors for FF3 provided by NIST, which are used for testing in this package.

To run unit tests on this implementation, including all test vectors from the NIST specification, run the command:

  1. python tests/pyfpe_ff3_test.py
  2. or python setup.py test

FF3 Algorithum

The FF3 algorithum is a tweakable block cipher based on an eight round Feistel cipher. A block cipher operates on fixed-length groups of bits, called blocks. A Feistel Cipher is not a specific cipher, but a design model. This FF3 Feistel encryption consisting of eight rounds of processing the plaintext. Each round applies an internal function or round function, followed by transformation steps.

The FF3 round function uses AES encryption in ECB mode, which is performed each iteration on alternating halves of the text being encrypted. The key value is used only to initialize the AES cipher. Thereafter the tweak is used together with the intermediate encrypted text as input to the round function.

Implementation Notes

This implementation was originally based upon the Capital One Go implemntation. It follows the algorithm as outlined in the NIST specification as closely as possible, including naming.

FPE can be used for data tokenization of sensitive data which is cryptographically reversible. This implementation does not provide any guarantees regarding PCI DSS or other validation.

While all NIST standard test vectors pass, this package has not otherwise been extensively tested.

As of Python 3.7, the standard library's int package supports radices/bases up to 36. Therefore, this release supports a max base of 36, which can contain numeric digits 0-9 and lowercase alphabetic characters a-z.

As an enhancement to increase the radix range, the standard libary base64 package supports base 64 for string conversion. The Fiestel algorithum requires Integer conversion is well and the result would need to as performant as existing BigInt. Added int2 function to convert to support radix 64 [0..9, a-z, A-Z, '-].

The cryptographic library used is PyCryptodome for AES encryption. FF3 uses a single-block with an IV of 0, which is effectively ECB mode. AES ECB is the only block cipher function which matches the requirement of the FF3 spec.

The domain size was revised in FF3-1 to radixminLen >= 1,000,000 and is represented by the constant DOMAIN_MIN in ff3.py. FF3-1 is in draft status and updated 56-bit test vectors are not yet available. Small domains can still be allowed using allow_small_domain boolean value in constructor.

The tweak is required in the initial FF3Cipher constructor, but can optionally be overriden in each encrypt and decrypt call. This is similar to passing an IV or nonce when creating an encryptor object.

Authors

Brad Schoening & Puspendu Banerjee puspendu.banerjee@gmail.com

License

This project is licensed under the terms of the Apache 2.0 license.

Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distributions

No source distribution files available for this release.See tutorial on generating distribution archives.

Built Distribution

If you're not sure about the file name format, learn more about wheel file names.

pyFPE-0.10.3-py3-none-any.whl (20.6 kB view details)

Uploaded Python 3

File details

Details for the file pyFPE-0.10.3-py3-none-any.whl.

File metadata

  • Download URL: pyFPE-0.10.3-py3-none-any.whl
  • Upload date:
  • Size: 20.6 kB
  • Tags: Python 3
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.4.2 importlib_metadata/4.8.1 pkginfo/1.7.1 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.2 CPython/3.8.3

File hashes

Hashes for pyFPE-0.10.3-py3-none-any.whl
Algorithm Hash digest
SHA256 510c170242dbb3e87d7da32c143ba4a87820c68ac4c63a9f94465b3874353440
MD5 efae7ad69c215494785dcd17c3d1c4e4
BLAKE2b-256 33552537dd4eaa725be96d12edabad70e45110bf88a6d8179bee5e530be9674e

See more details on using hashes here.

Release history Release notifications | RSS feed

This release

0.10.3 This release

1 file

0.10.2

1 file

0.10.0

1 file

Anthropic, PBC Visionary sponsor Bloomberg Visionary sponsor Hudson River Trading Visionary sponsor Meta Visionary sponsor NVIDIA Visionary sponsor Microsoft Sustainability sponsor Depot Continuous Integration AWS Cloud computing and Security Sponsor Datadog Monitoring Fastly CDN Google Download Analytics Sentry Error logging StatusPage Status page