Skip to main content

Analysis of transposon insertion sequencing (INSeq) data in Python

Project description

Build Status Python 3.7 Python 3.8

logo

Lightweight python package to map transposon insertion sequencing (INSeq) data in bacteria.

Quick start

This section is meant for users who know their way around terminal and conda. To use pyinseq, create a virtual environment with python 3.7 and install pyinseq using conda.

$ conda install -n base -c conda-forge mamba
$ conda create -n pyinseq-py37 python=3.7
$ conda activate pyinseq-py37
(pyinseq-py37) $ conda install -c bioconda bowtie
(pyinseq-py37) $ pip install pyinseq

Verify your installation with --test

(pyinseq-py37) $ pyinseq --test

Now you can run pyinseq!

(pyinseq-py37) $ pyinseq -i <input file> -s <sample file> -g <genbank file> -e <experiment name>

Table of contents

Overview of Command Line Operation

Basic operation and a short description of the files are listed here. Below are detailed descriptions and links to example input files.

$ pyinseq -i <input file> -s <sample file> -g <genbank file> -e <experiment name>

-i / --input

  • Illumina reads file in FASTQ or gzipped-FASTQ format.

-s / --samples

  • Sample list where each line is the sample_name <tab> barcode (4bp).

-g / --genome

  • Concatenated GenBank File for all contigs for the genome.

-e / --experiment

  • All results files will be created in a subfolder with this name.

Snakemake

--get_default_config

  • Creates a default configuration file for running pyinseq

--config_format

  • File format for configuration file (yaml or json)

-c/ --config

  • Configuration file for running a pyinseq workflow. Every other argument will be ignored.

--test

  • Runs pytest on installed pyinseq software.

Optional arguments

--gff

  • Generate genome output file in gff3 format.

-d / --disruption

  • Five-prime fraction of gene (0.0 - 1.0) that must be disrupted for the hit to be counted in the summary_gene_table. Often insertions at the 3' end of a gene do not disrupt function so it may be of interest to run the pipeline with a disruption value of 0.8 or 0.9. [default: 0.9]

--min_count

  • Minimum number of reads per insertion site. [default: 3]

--max_ratio

  • Maximum ratio of left:right or right:left reads per insertion site. [default: 10]

--barcode_length

  • Length of barcode index that is expected in samples. [default: 4]

--transposon_seq

  • DNA sequence of transposon that flanks reads. [default: 'ACAGGTTG']

-t / --threads

  • Number of cores to use for execution [default: the CPU count of the computer]

--snakemake_params

  • Additional parameters that will get passed to snakemake.

Output description

File Description
<experiment name>-config.yml Configuration file with run parameters
results/summary_gene_table.txt summary for entire experiment (values in counts-per-million, cpm)
results/<sample>_sites.txt (for each sample) Counts of each insertion in each sample
results/<sample>_genes.txt (for each sample) Counts of each insertion mapped to genes
results/<sample>_bowtie.txt (for each sample) Bowtie mapping results
results/<sample>_trimmed.fastq (for each sample) Demultiplexed fastq reads trimmed for the chromosome sequence only
results/log.txt text printed to console
results/samples_info_yml basics stats for each sample
results/genome_lookup/genome.fna genome fasta nucleotide file
results/genome_lookup/genome.ftt genome feature table
bowtie indexes index files created from genome by bowtie
results/raw_data/<sample>.fastq (for each sample) demultiplexed files for each sample/barcode
results/raw_data/_other.fastq demultiplexed files for unrecognized barcodes

Notes on output

T50

  • The minimum number of transposon insertion sites in the sample that account for at least 50% of the samples's reads. Used as a crude measure to detect bottlenecks, when comparing output T50 to the library input T50, or when comparing biological or technical replicates.

samples_info.yml

  • Contains basic information of each sample in the experiment.

log.txt

  • Log file from pyinseq, including the messages from the snakemake execution. This includes the order of steps taken during the pyinseq execution.

<experiment name>-config.yaml

  • Configuration file with run parameters.

Background

pyinseq was inspired by the software published by Goodman et al. (2011). There are a number of differences, some of which are noted here. Most are fairly superficial in that they are intended to increase automation and reproducibility but do not materially affect the results. One exception is the first point, which does affect the resulting output.

  1. As was conducted in Brooks et al. (2014) transposon site data are normalized across all replicons (chromosomes/plasmids/contigs) for calculation of a counts-per-million (cpm) per sample.

  2. The user's file of reads is demultiplexed into separate .fastq files for each barcoded read.

  3. The user provides a GenBank file, and pyinseq generates a fasta nucleotide file (.fna) and gene feature table (.ftt) that are formatted and named properly for bowtie.

  4. The gene feature table (.ftt) is comparable to the protein feature table (.ptt) but it also includes RNA genes.

  5. If pyinseq is installed from conda, then bowtie is installed from conda as a dependency.

  6. At the end of the analysis, results are aggregated into a tab-delimited table and sample info is summarized.

  7. pyinseq is written primarily in Python and uses snakemake as the workflow manager. You probably figured that out already.

User guide

Input files description

Illumina sequencing reads [-i] for the experiment. File can be uncompressed (.fastq or .fq) or gzip-compressed (.fastq.gz or .fq.gz).

Example input file

@DGL9ZZQ1:720:C6YD0ACXX:2:1101:1246:2185 1:N:0:
GAAGCGACACCGACGACGGTAACAGGTTGGATGATAAGTCCCCGGTCTTCG
+
CCCFFFDDHHHHHCGHHHIJDHIIJJFHHJIJJJJIJJDHIJJHIAGIJJJ
...

Sample file [-s] describing the sample names and barcodes. Sample names should be restricted to letters, numbers, dash (-), and underscore (_), with a tab between the sample and the barcode in each row of a text file. It is recommended that the file be prepared in a text editor to ensure that additional hidden characters are not introduced. BBEdit is one option for Mac.

Microsoft Excel can export tab-delimited files (.tsv), but do not use Microsoft Word for this purpose.

Example sample file

E001_01 GAAG
E001_02 CTTT

GenBank file [-g] listing the features and DNA sequence for the organism. If the organism has multiple chromosomes/contigs in the sequence the file they should be concatenated into a single file. Ensure that the double slash // at the end of the file remains to separate each contig.

Files from NCBI GenBank often work where the corresponding files from NCBI RefSeq do not. Feel free to contact us with any questions here.

Example GenBank file

LOCUS       CP000020             2897536 bp    DNA     circular BCT 02-APR-2008
DEFINITION  Vibrio fischeri ES114 chromosome I, complete sequence.
ACCESSION   CP000020
VERSION     CP000020.2  GI:171902228
KEYWORDS    .
SOURCE      Vibrio fischeri ES114
...
FEATURES             Location/Qualifiers
     source          1..2897536
                     /organism="Vibrio fischeri ES114"
                     /mol_type="genomic DNA"
                     /strain="ES114"
                     /db_xref="taxon:312309"
                     /chromosome="I"
     gene            complement(313..747)
                     /gene="mioC"
                     /locus_tag="VF_0001"
                     /old_locus_tag="VF0001"
     CDS             complement(313..747)
                     /dnas_title="FMN-binding protein MioC"
                     /gene="mioC"
                     /locus_tag="VF_0001"
                     /old_locus_tag="VF0001"
                     /codon_start=1
                     /transl_table=11
                     /product="FMN-binding protein MioC"
                     /protein_id="AAW84496.1"
                     /db_xref="GI:59478709"
                     /translation="MKKVSIITGSTLGGAEYVGDHLADLLEEMDFSTDIHNQPNLDDI
                     DIDSLWLLVVSTHGAGDYPDNIKPFIQQLESVTQPLSSVEFAVVAIGDSSYDTFCAAG
                     KSLQNTLKEHGAIEKYPLLEIDVTQNSIPEEPAELWLKQHIC"
...
ORIGIN
        1 aagatcactt aatatatata agatctttta aagagatctt ttattagatc tattatatag
       61 atcgtcgatc tctgtggata agtgataaat gatcaatagg atcatatact ttagatggat
      121 ccaaagttgt tatctttctt tgatcttcga tcggacagct tgaggacaaa agagttagtt
      181 atccacaagg ggggagggcg ttagatctta ttcaatggat aactataact tgatcactgg
      241 atctttctat agttatccac atagtaggta tcatctattt aataactttt atagatcgga
      301 caacactttt tattaacaaa tgtgttgttt tagccacaat tctgctggtt cttcagggat
      361 actattttga gttacatcta tctctaatag agggtacttt tcgatagcgc catgctcttt
      421 taaggtattt tgaagtgatt ttcctgctgc gcagaaagtg tcataacttg aatcaccgat
      481 agcaacaaca gcaaattcaa cgctcgataa tggctgagtc acgctttcta actgttgaat
      541 aaatggttta atgttgtcag ggtaatcacc agcaccgtga gttgatacaa cgagtaacca
      601 taagctatca atatcaatat catctaaatt tggttgatta tgaatatcgg tggaaaaatc
      661 catttcttct aataaatcag caagatggtc accaacatac tcagcaccac ctagagtgct
      721 tcctgtaata atagatactt ttttcatgaa tttatcctat aaaaatataa aaaatgggcc
      781 tacataggcc cattattaat cttattaata ttggttttat ttaccaatac agaatgaagt
...
//
LOCUS       CP000021             1330333 bp    DNA     circular BCT 02-APR-2008
DEFINITION  Vibrio fischeri ES114 chromosome II, complete sequence.
...

General Usage

Pyinseq uses snakemake to execute the following workflow:

pyinseq

  • Demultiplex a file of FASTQ reads.
  • Write separate trimmed versions of the files (no barcodes, no transposon sequence).
  • Map the trimmed reads to the genome.
  • Quantify insertions per site and per ORF in the genome.
  • Output summary gene table and report files describing the dataset.

The benefit of using snakemake is that it allows for parallel execution if more than one thread is provided. The modularity of snakemake enables future feature implementation.

Run Parameters (Config File)

pyinseq writes a configuration file (<experiment name>-config.yaml) into the working directory, which holds the parameters for the run. For the example command below, the pyinseq-config.yaml file will store the parameters used for this run.

$ pyinseq -i reads.fastq -s samples.txt -g genome.gbk -e pyinseq --threads 4

Example Config File

$ cat demo-run-config.yaml
snakemake_params: []
barcode_length: 4
command: pyinseq
config: false
config_format: yaml
disruption: 0.9
experiment: demo-run
genome: genome.gbk
get_default_config: false
gff3: false
input: reads.fastq.gz
max_ratio: 10
min_count: 3
samples: samples.txt
threads: 4
transposon_seq: ACAGGTTG

If you installed conda in your terminal, you can use the option --use-conda which will install bowtie during the executuion of the workflow.

$ pyinseq -i reads.fastq -s samples.txt -g genome.gbk -e demo-run --threads 4 --snakemake_params --use-conda 

You can also get a default configuration file by using --get_default_config and modify it using a text-editor.

$ pyinseq --get_default_config
$ ls
default-config-pyinseq.yaml

Make sure that all file paths in the configuration are correct

Specialized tasks

These commands are useful when combining samples from multiple Illumina runs in a single pyinseq analysis. Both commands will also create a configuration file specific to each subcommand.

pyinseq demultiplex

  • Demultiplex a file of Illumina reads.
  • Writes separate trimmed versions of the files (no barcode, no transposon sequence) unless the optional --notrim flag is added.
$ pyinseq demultiplex -i <input file> -s <sample file> -e <experiment name>

pyinseq genomeprep

  • Prepare the fasta nucleotide (.fna) and feature table (.ftt) files from a GenBank file.
  • Is a good quick test to run on new GenBank files.
  • Generates bowtie indexes unless the --noindex flag is added.
  • Optionally create GFF3 file with the -gff flag (for use in other programs).
$ pyinseq genomeprep -g <genbank file> -e <experiment name>

Similar to pyinseq main usage, you can run these commands using a configuration file and pass additional snakemake options.

Installation

Requirements

pyinseq was written and tested using a MacOS (or Linux-based) operating system.

pyinseq has not being tested on Windows operating systems, but as of Windows 10 there is support for terminals with Ubuntu

Also note that pyinseq uses bowtie; not bowtie2, which is a different software.

Installation in a conda environment (recommended)

Conda is a command-line package manager that can create virtual environments with all the necessary dependencies to run pyinseq. You can acquire conda by installing Anaconda and all the packages it brings, or by installing its lightweight version called miniconda. We recommend miniconda since it installs a minimal number packages, and is actually all you need to run pyinseq

Once conda is installed, you can verify it by running:

$ conda --help

Installing mamba

mamba is now required for snakemake. Install it system-wide with this command. The subsequent steps are shown using conda since that is more common for the scientific audience, but can largely be accomplished in mamba if the user desires.

conda install -n base -c conda-forge mamba

Creating a virtual environment

A virtual environment is an isolated computational space where you can install dependencies and software without affecting the base operating system's configuration. We can use conda to create a virtual environment with python 3.7

$ conda create -n pyinseq-py37 python=3.7

To activate your environment:

$ conda activate pyinseq-py37

You should see the name of your environment surrounded by parentheses in your terminal prompt.

(pyinseq-py37) $ 

Install bowtie:

(pyinseq-py37) $ conda install -c bioconda bowtie

Install pyinseq:

Install the stable version:

(pyinseq-py37) $ pip install pyinseq

Or, install the most recent version from GitHub:

(pyinseq-py37) $ pip install git+https://github.com/mjmlab/pyinseq

Verify your installation with --test

(pyinseq-py37) $ pyinseq --test


Verify that pyinseq installed correctly by running:

```bash
(pyinseq-py37) $ pyinseq --help
2021-05-26 13:10 - INFO - pyinseq - Process command line arguments
usage: pyinseq [-h] [--get_default_config] [--config_format CONFIG_FORMAT]
               [-c CONFIG] [-t THREADS] [--snakemake_params ...] [-v]
               [-i INPUT] [-s SAMPLES] [-e EXPERIMENT] [-g GENOME]
               [-d DISRUPTION] [--min_count MIN_COUNT] [--max_ratio MAX_RATIO]
               [--barcode_length BARCODE_LENGTH]
               [--transposon_seq TRANSPOSON_SEQ] [--gff3]
               {demultiplex,genomeprep} ...
...

Now you are ready to run pyinseq!

Testing

You can test your installation of pyinseq by using the option --test.

(pyinseq-py37) $ pyinseq --test

If all tests pass then you are good to go!

FAQ

Why do I get errors in processing the GenBank file?

Ensure that the file is in GenBank and not RefSeq format.

How do I uninstall pyinseq?

You can do this two ways:

  • uninstalling pyinseq from the virtual environment

pip uninstall pyinseq

  • or completely remove the conda virtual environment.

conda env remove -n pyinseq-py37

Note: will need to conda deactivate first to leave the environment.

How can I notify of an issue with pyinseq

Please use the GitHub Issues.

License

Pyinseq is an open-source software licensed under BSD-3.

Project details


Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

pyinseq-0.3.2.tar.gz (37.2 MB view details)

Uploaded Source

Built Distribution

If you're not sure about the file name format, learn more about wheel file names.

pyinseq-0.3.2-py3-none-any.whl (37.5 MB view details)

Uploaded Python 3

File details

Details for the file pyinseq-0.3.2.tar.gz.

File metadata

  • Download URL: pyinseq-0.3.2.tar.gz
  • Upload date:
  • Size: 37.2 MB
  • Tags: Source
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/4.0.0 CPython/3.8.13

File hashes

Hashes for pyinseq-0.3.2.tar.gz
Algorithm Hash digest
SHA256 081f7d9aa81518949eb80c0f5fd9ed485b45b2a8ca4f755ba2414d84a81d6b43
MD5 3dc157ea5436b61a9a550ac6272ee78f
BLAKE2b-256 a78f779d521bdbf12ec2a26d68baff550c7f7eb4447c662448d0145b46e92fab

See more details on using hashes here.

File details

Details for the file pyinseq-0.3.2-py3-none-any.whl.

File metadata

  • Download URL: pyinseq-0.3.2-py3-none-any.whl
  • Upload date:
  • Size: 37.5 MB
  • Tags: Python 3
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/4.0.0 CPython/3.8.13

File hashes

Hashes for pyinseq-0.3.2-py3-none-any.whl
Algorithm Hash digest
SHA256 a17f52eadc7700bf71b68eb804ef6270bc6f9ac3e98d7d12f6c554c16edffe7d
MD5 7b19117b5cef628365985a07828abc3c
BLAKE2b-256 262fa5dc8099103281daa1955903b843328fa0ce3bb7e10115f0dc71bc64b4d0

See more details on using hashes here.

Supported by

AWS Cloud computing and Security Sponsor Datadog Monitoring Depot Continuous Integration Fastly CDN Google Download Analytics Pingdom Monitoring Sentry Error logging StatusPage Status page