PyOPA - optimal pairwise sequence alignments
Project description
This python package provides a fast implementation to compute
optimal pairwise alignments of molecular sequences
ML distance estimates of pairwise alignments.
The implementation uses Farrar’s algorithm <http://bioinformatics.oxfordjournals.org/content/23/2/156.abstract>_ to compute the optimal pairwise alignment using SSE vectorization operations. This package implements the Smith-Waterman and Needleman-Wunsch algorithm to compute the local and global sequence alignments.
Example
import pyopa
log_pam1_env = pyopa.read_env_json(os.path.join(pyopa.matrix_dir(), 'logPAM1.json'))
s1 = pyopa.Sequence('GCANLVSRLENNSRLLNRDLIAVKINADVYKDPNAGALRL')
s2 = pyopa.Sequence('GCANPSTLETNSQLVNRELIAVKINPRVYKGPNLGAFRL')
# super fast check whether the alignment reaches a given min-score
min_score = 100
pam250_env = pyopa.generate_env(log_pam1_env, 250, min_score)
pyopa.align_short(s1, s2, pam250_env)
Project details
Download files
Download the file for your platform. If you're not sure which to choose, learn more about installing packages.
Source Distribution
Built Distributions
File details
Details for the file pyopa-0.8.4.tar.gz
.
File metadata
- Download URL: pyopa-0.8.4.tar.gz
- Upload date:
- Size: 4.0 MB
- Tags: Source
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/4.0.2 CPython/3.9.17
File hashes
Algorithm | Hash digest | |
---|---|---|
SHA256 | f83d1a7fddeb8e5d4abd63c38c9f638b2330ef323b2501031b4f9efa67abe819 |
|
MD5 | 2487f8a1cdabf51103e0b822eae6d91c |
|
BLAKE2b-256 | 71f01485ea7333f19d8bf677ead6bdc5b543941f58c2c68fa76e68d9a3b4631f |
File details
Details for the file pyopa-0.8.4-cp311-cp311-musllinux_1_1_x86_64.whl
.
File metadata
- Download URL: pyopa-0.8.4-cp311-cp311-musllinux_1_1_x86_64.whl
- Upload date:
- Size: 4.1 MB
- Tags: CPython 3.11, musllinux: musl 1.1+ x86-64
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/4.0.2 CPython/3.9.17
File hashes
Algorithm | Hash digest | |
---|---|---|
SHA256 | 23a4627a018de0eb9539e158d77d4016af93c147bcbcb07cb20f7d8be7ccc824 |
|
MD5 | 7c4dfe46744fc24e1acc57f39fbd20c0 |
|
BLAKE2b-256 | 86a0843bcaf1fe9f67bb81980b57ce2a5f5ccded404cf7c4d9cd012266c03b85 |
File details
Details for the file pyopa-0.8.4-cp311-cp311-manylinux_2_17_x86_64.manylinux2014_x86_64.whl
.
File metadata
- Download URL: pyopa-0.8.4-cp311-cp311-manylinux_2_17_x86_64.manylinux2014_x86_64.whl
- Upload date:
- Size: 4.0 MB
- Tags: CPython 3.11, manylinux: glibc 2.17+ x86-64
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/4.0.2 CPython/3.9.17
File hashes
Algorithm | Hash digest | |
---|---|---|
SHA256 | 8a40517c93fcaa44608b94dd58b446e4a6a8d2ad52efa42b6c7bc99288474479 |
|
MD5 | c1cde98e7e10d30823a44a5063566033 |
|
BLAKE2b-256 | b5ad3518ffa17dc52e8a653b82a2bcab488e2041d258659817ee153d9cc3b03b |
File details
Details for the file pyopa-0.8.4-cp311-cp311-macosx_11_0_arm64.whl
.
File metadata
- Download URL: pyopa-0.8.4-cp311-cp311-macosx_11_0_arm64.whl
- Upload date:
- Size: 3.5 MB
- Tags: CPython 3.11, macOS 11.0+ ARM64
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/4.0.2 CPython/3.9.17
File hashes
Algorithm | Hash digest | |
---|---|---|
SHA256 | 7699a06132a614915a8927d7d1367ef9e83f8707b17880a091be9b4638332d7a |
|
MD5 | 504959de2946772698157682b54f9f7d |
|
BLAKE2b-256 | 141db64e6a264cb5fbae5f44a59d2a4a805ca9d18cf5992c0cb13eef2c28910d |
File details
Details for the file pyopa-0.8.4-cp311-cp311-macosx_10_9_x86_64.whl
.
File metadata
- Download URL: pyopa-0.8.4-cp311-cp311-macosx_10_9_x86_64.whl
- Upload date:
- Size: 3.5 MB
- Tags: CPython 3.11, macOS 10.9+ x86-64
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/4.0.2 CPython/3.9.17
File hashes
Algorithm | Hash digest | |
---|---|---|
SHA256 | 1d08b21177d97bfdaee90148ece8e2b3c7579c4a211638ea5852b6607b464da3 |
|
MD5 | c1e23675aec9f3f2c685c82c83fa43c6 |
|
BLAKE2b-256 | bb4bc0ca7757a975abf8ac2af01ca3dddd9ca817e6f5139ed18843cfe9da3f92 |
File details
Details for the file pyopa-0.8.4-cp310-cp310-musllinux_1_1_x86_64.whl
.
File metadata
- Download URL: pyopa-0.8.4-cp310-cp310-musllinux_1_1_x86_64.whl
- Upload date:
- Size: 4.0 MB
- Tags: CPython 3.10, musllinux: musl 1.1+ x86-64
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/4.0.2 CPython/3.9.17
File hashes
Algorithm | Hash digest | |
---|---|---|
SHA256 | f184f4b36fc8e4dd03c59a600b3256f12d39d02fb790469309931c87f78306f4 |
|
MD5 | d89721e27e0a159a38d03e36d69c71ca |
|
BLAKE2b-256 | aecfa7276fbf5cae01ecfc81575f831969229903403556de0508b1bef1786747 |
File details
Details for the file pyopa-0.8.4-cp310-cp310-manylinux_2_17_x86_64.manylinux2014_x86_64.whl
.
File metadata
- Download URL: pyopa-0.8.4-cp310-cp310-manylinux_2_17_x86_64.manylinux2014_x86_64.whl
- Upload date:
- Size: 4.0 MB
- Tags: CPython 3.10, manylinux: glibc 2.17+ x86-64
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/4.0.2 CPython/3.9.17
File hashes
Algorithm | Hash digest | |
---|---|---|
SHA256 | 067e0f692077c83b5b3344fbbd64f5d7439054ee7e986796cd1ec090885e1482 |
|
MD5 | 376ba7b4231d8dbef11d3da85baadafb |
|
BLAKE2b-256 | e9f364abfabb8c3419c2287def9f58bcd079aeefc937b8101158050444339cdb |
File details
Details for the file pyopa-0.8.4-cp310-cp310-macosx_11_0_arm64.whl
.
File metadata
- Download URL: pyopa-0.8.4-cp310-cp310-macosx_11_0_arm64.whl
- Upload date:
- Size: 3.5 MB
- Tags: CPython 3.10, macOS 11.0+ ARM64
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/4.0.2 CPython/3.9.17
File hashes
Algorithm | Hash digest | |
---|---|---|
SHA256 | bdea0dc270fcd6496b1c932e8762b0f7919cd6a9a26dd152bd40041300684a17 |
|
MD5 | 38241a1ae54a3be0044387d1d1215775 |
|
BLAKE2b-256 | d0b8a82eb425d424d592b7ed199d08c2a5b3eb315a276c85115ad9bbd6c3d34b |
File details
Details for the file pyopa-0.8.4-cp310-cp310-macosx_10_9_x86_64.whl
.
File metadata
- Download URL: pyopa-0.8.4-cp310-cp310-macosx_10_9_x86_64.whl
- Upload date:
- Size: 3.5 MB
- Tags: CPython 3.10, macOS 10.9+ x86-64
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/4.0.2 CPython/3.9.17
File hashes
Algorithm | Hash digest | |
---|---|---|
SHA256 | 1fd0b6dbfcd0397390065f0cecb973cc0daf1d98e2473bc4d4d0bc5cb7aa8b30 |
|
MD5 | c85c73e7d6522c875fb4f9c769d5dc38 |
|
BLAKE2b-256 | ecbc01970349d53dea379e7cbf664f15b0d059d219dcabc5f695125773f2f5bc |
File details
Details for the file pyopa-0.8.4-cp39-cp39-musllinux_1_1_x86_64.whl
.
File metadata
- Download URL: pyopa-0.8.4-cp39-cp39-musllinux_1_1_x86_64.whl
- Upload date:
- Size: 4.1 MB
- Tags: CPython 3.9, musllinux: musl 1.1+ x86-64
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/4.0.2 CPython/3.9.17
File hashes
Algorithm | Hash digest | |
---|---|---|
SHA256 | d375a5092e22a5635387270b2fbbc5aa380810ea58993f82d1b81d0e4950be51 |
|
MD5 | f866725b1a536c2e6180e7d832b50160 |
|
BLAKE2b-256 | 470a98ee752cbb29a5cb3c677c485b34e0fb4794815fb271967508385568575c |
File details
Details for the file pyopa-0.8.4-cp39-cp39-manylinux_2_17_x86_64.manylinux2014_x86_64.whl
.
File metadata
- Download URL: pyopa-0.8.4-cp39-cp39-manylinux_2_17_x86_64.manylinux2014_x86_64.whl
- Upload date:
- Size: 4.0 MB
- Tags: CPython 3.9, manylinux: glibc 2.17+ x86-64
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/4.0.2 CPython/3.9.17
File hashes
Algorithm | Hash digest | |
---|---|---|
SHA256 | bc7784364e255bfad3bc102a4b88c891216db03d7104fe9f26f2b8e488f9cac6 |
|
MD5 | 5701ff286d4d8b99d6003ea569097d5c |
|
BLAKE2b-256 | 00bb5e1e3ff7569748713826ff739bb27fb9095d31c32378f8cfdbcee29c1721 |
File details
Details for the file pyopa-0.8.4-cp39-cp39-macosx_11_0_arm64.whl
.
File metadata
- Download URL: pyopa-0.8.4-cp39-cp39-macosx_11_0_arm64.whl
- Upload date:
- Size: 3.5 MB
- Tags: CPython 3.9, macOS 11.0+ ARM64
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/4.0.2 CPython/3.9.17
File hashes
Algorithm | Hash digest | |
---|---|---|
SHA256 | 274301ea0bad35f16a66484b9c2fb0a10cf3302abbad565454447f3846f12156 |
|
MD5 | 1cdf8fc4da3645f6f21b737cb8ce9bad |
|
BLAKE2b-256 | 542a636fe95a20cfd22928055889a760d1b295ee00efcee1c8303731457868c9 |
File details
Details for the file pyopa-0.8.4-cp39-cp39-macosx_10_9_x86_64.whl
.
File metadata
- Download URL: pyopa-0.8.4-cp39-cp39-macosx_10_9_x86_64.whl
- Upload date:
- Size: 3.5 MB
- Tags: CPython 3.9, macOS 10.9+ x86-64
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/4.0.2 CPython/3.9.17
File hashes
Algorithm | Hash digest | |
---|---|---|
SHA256 | ff16bc7bb7a3f488c06f1aa0a5e7aa0268afe5bec77830276a36ef873802d4d2 |
|
MD5 | 3f848bc22be0adb67b52b3d695d7f1e9 |
|
BLAKE2b-256 | df3c4db4e7ac853c576f04add4d321cb000bfd2dca9fd7c896ebea63628f2bca |
File details
Details for the file pyopa-0.8.4-cp38-cp38-musllinux_1_1_x86_64.whl
.
File metadata
- Download URL: pyopa-0.8.4-cp38-cp38-musllinux_1_1_x86_64.whl
- Upload date:
- Size: 4.1 MB
- Tags: CPython 3.8, musllinux: musl 1.1+ x86-64
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/4.0.2 CPython/3.9.17
File hashes
Algorithm | Hash digest | |
---|---|---|
SHA256 | f006a1eb5fa848b5cecc2fa8bcbffb2201933504ea3fff08608b210210c778bd |
|
MD5 | 005af4d66507bc3b321fbd02f3cfea0d |
|
BLAKE2b-256 | e754af0ec6dbcfc5f97b5b1ceb36b8d4c2c246836407c0da60de4d011a14aad2 |
File details
Details for the file pyopa-0.8.4-cp38-cp38-manylinux_2_17_x86_64.manylinux2014_x86_64.whl
.
File metadata
- Download URL: pyopa-0.8.4-cp38-cp38-manylinux_2_17_x86_64.manylinux2014_x86_64.whl
- Upload date:
- Size: 4.0 MB
- Tags: CPython 3.8, manylinux: glibc 2.17+ x86-64
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/4.0.2 CPython/3.9.17
File hashes
Algorithm | Hash digest | |
---|---|---|
SHA256 | d0b07a8d01cc83ad99b2b958f2f829f2c62b04f2ff7b31c0fc9380714c03ba6b |
|
MD5 | b9ec801d53af4efb278a7ce2626f30e7 |
|
BLAKE2b-256 | 0986c34d8ed86ef8fd382ace8df50b45a08cec91fc08e96da53edaadeba88a79 |
File details
Details for the file pyopa-0.8.4-cp38-cp38-macosx_11_0_arm64.whl
.
File metadata
- Download URL: pyopa-0.8.4-cp38-cp38-macosx_11_0_arm64.whl
- Upload date:
- Size: 3.5 MB
- Tags: CPython 3.8, macOS 11.0+ ARM64
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/4.0.2 CPython/3.9.17
File hashes
Algorithm | Hash digest | |
---|---|---|
SHA256 | 841e8fb227d1305853f87e454b6e186962b5bb8efcb82880fee1ebe4f43a5fc6 |
|
MD5 | 3da900b417bfb61ae52f432902a78885 |
|
BLAKE2b-256 | cb590b7df4997e01432323fef687056c30708b7b6c6f7f2679be6b9ebd8b5a81 |
File details
Details for the file pyopa-0.8.4-cp38-cp38-macosx_10_9_x86_64.whl
.
File metadata
- Download URL: pyopa-0.8.4-cp38-cp38-macosx_10_9_x86_64.whl
- Upload date:
- Size: 3.5 MB
- Tags: CPython 3.8, macOS 10.9+ x86-64
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/4.0.2 CPython/3.9.17
File hashes
Algorithm | Hash digest | |
---|---|---|
SHA256 | 67b8204023ee0926bd755f735946dc1fc11ada09ec7d4e2835cf80f300bf043c |
|
MD5 | 79de5d4951008864ae993898a36662a4 |
|
BLAKE2b-256 | c90f5d450fc448c9b10051bdb4eb02ada402c85f321870d7a4ace5ca84901ac2 |
File details
Details for the file pyopa-0.8.4-cp37-cp37m-musllinux_1_1_x86_64.whl
.
File metadata
- Download URL: pyopa-0.8.4-cp37-cp37m-musllinux_1_1_x86_64.whl
- Upload date:
- Size: 4.0 MB
- Tags: CPython 3.7m, musllinux: musl 1.1+ x86-64
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/4.0.2 CPython/3.9.17
File hashes
Algorithm | Hash digest | |
---|---|---|
SHA256 | be72a0a6a97f023bb8ffe1612cbe82487f08502ae4a315644abe3c8918fb2250 |
|
MD5 | 9a3db71bf53c2b5ee22f2dd28017bc38 |
|
BLAKE2b-256 | a517b03cf6b9b17abd08d4e9165443b317935291ef1ac568c24d8e350e0e6ee0 |
File details
Details for the file pyopa-0.8.4-cp37-cp37m-manylinux_2_17_x86_64.manylinux2014_x86_64.whl
.
File metadata
- Download URL: pyopa-0.8.4-cp37-cp37m-manylinux_2_17_x86_64.manylinux2014_x86_64.whl
- Upload date:
- Size: 4.0 MB
- Tags: CPython 3.7m, manylinux: glibc 2.17+ x86-64
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/4.0.2 CPython/3.9.17
File hashes
Algorithm | Hash digest | |
---|---|---|
SHA256 | d897e5d38c86b6e0b1418449c420ac84f18baf000278ea0bfd47568a85b02463 |
|
MD5 | 6789afeac1ffec806640248834dce1c2 |
|
BLAKE2b-256 | 459a0379fdeebacce224f7979166e4727afbcac149d6809df9e1e8c2fa04a4d5 |
File details
Details for the file pyopa-0.8.4-cp37-cp37m-macosx_10_9_x86_64.whl
.
File metadata
- Download URL: pyopa-0.8.4-cp37-cp37m-macosx_10_9_x86_64.whl
- Upload date:
- Size: 3.5 MB
- Tags: CPython 3.7m, macOS 10.9+ x86-64
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/4.0.2 CPython/3.9.17
File hashes
Algorithm | Hash digest | |
---|---|---|
SHA256 | 029fcacb44d2bcd1f5dced906037b4e17c6eb583cb15c6b52a208f3d28177520 |
|
MD5 | afdf5f943a9328cbca125bb2af8f8c0d |
|
BLAKE2b-256 | 9906f5f5be416aea98ff9021809ff28d47ea648f8d89c68ae8df36bc335c9ead |
File details
Details for the file pyopa-0.8.4-cp36-cp36m-musllinux_1_1_x86_64.whl
.
File metadata
- Download URL: pyopa-0.8.4-cp36-cp36m-musllinux_1_1_x86_64.whl
- Upload date:
- Size: 4.0 MB
- Tags: CPython 3.6m, musllinux: musl 1.1+ x86-64
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/4.0.2 CPython/3.9.17
File hashes
Algorithm | Hash digest | |
---|---|---|
SHA256 | 37eaf805ce193eb288a38e4b4731f0a0f7f1a1b8b7c904efdfb8ed53cc084fbe |
|
MD5 | 27a9b0ac5ca4d94716decdb48fd9c137 |
|
BLAKE2b-256 | a75977f971c9a8cf0f6bb67ed13c759822c99d1e196e2471e31a164eb5aa9c20 |
File details
Details for the file pyopa-0.8.4-cp36-cp36m-manylinux_2_17_x86_64.manylinux2014_x86_64.whl
.
File metadata
- Download URL: pyopa-0.8.4-cp36-cp36m-manylinux_2_17_x86_64.manylinux2014_x86_64.whl
- Upload date:
- Size: 3.9 MB
- Tags: CPython 3.6m, manylinux: glibc 2.17+ x86-64
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/4.0.2 CPython/3.9.17
File hashes
Algorithm | Hash digest | |
---|---|---|
SHA256 | 37261da0339e77bb1c80b01844906db3df19817e277e334681621d4e03e7c951 |
|
MD5 | 4b1158e2e9a7b1c29611b879b4a9425c |
|
BLAKE2b-256 | 32833397ffa734da7b190b314003c9d1092971fa8f5c51136f5ab0965f8a881b |
File details
Details for the file pyopa-0.8.4-cp36-cp36m-macosx_10_9_x86_64.whl
.
File metadata
- Download URL: pyopa-0.8.4-cp36-cp36m-macosx_10_9_x86_64.whl
- Upload date:
- Size: 3.5 MB
- Tags: CPython 3.6m, macOS 10.9+ x86-64
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/4.0.2 CPython/3.9.17
File hashes
Algorithm | Hash digest | |
---|---|---|
SHA256 | db24b34516d04ad51ec38391f92f7a3900dadd2ffaff43294be6b1405e028be3 |
|
MD5 | c2d48e1b4c4fadc26adb4f8620d9e8ea |
|
BLAKE2b-256 | 2486ad15c59157bf28522364ae422adda1b3f0c69c07d22fc0e59595f2cf3960 |