Skip to main content

This python package provides a fast implementation to compute

  • optimal pairwise alignments of molecular sequences

  • ML distance estimates of pairwise alignments.

The implementation uses Farrar’s algorithm <http://bioinformatics.oxfordjournals.org/content/23/2/156.abstract>_ to compute the optimal pairwise alignment using SSE vectorization operations. This package implements the Smith-Waterman and Needleman-Wunsch algorithm to compute the local and global sequence alignments.

Installation

You can install the package using pip:

pip install pyopa

We provide wheels for Linux, MacOS (x86_64) and (arm64) for cpython.

Example

import pyopa
log_pam1_env = pyopa.read_env_json(os.path.join(pyopa.matrix_dir(), 'logPAM1.json'))
s1 = pyopa.Sequence('GCANLVSRLENNSRLLNRDLIAVKINADVYKDPNAGALRL')
s2 = pyopa.Sequence('GCANPSTLETNSQLVNRELIAVKINPRVYKGPNLGAFRL')

# super fast check whether the alignment reaches a given min-score
min_score = 100
pam250_env = pyopa.generate_env(log_pam1_env, 250, min_score)
pyopa.align_short(s1, s2, pam250_env)

Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

pyopa-0.8.6.tar.gz (4.0 MB view details)

Uploaded Source

Built Distributions

If you're not sure about the file name format, learn more about wheel file names.

pyopa-0.8.6-cp313-cp313-musllinux_1_2_x86_64.whl (4.2 MB view details)

Uploaded CPython 3.13musllinux: musl 1.2+ x86-64

pyopa-0.8.6-cp313-cp313-manylinux_2_17_x86_64.manylinux2014_x86_64.whl (4.1 MB view details)

Uploaded CPython 3.13manylinux: glibc 2.17+ x86-64

pyopa-0.8.6-cp313-cp313-macosx_11_0_arm64.whl (3.5 MB view details)

Uploaded CPython 3.13macOS 11.0+ ARM64

pyopa-0.8.6-cp313-cp313-macosx_10_13_x86_64.whl (3.6 MB view details)

Uploaded CPython 3.13macOS 10.13+ x86-64

pyopa-0.8.6-cp312-cp312-musllinux_1_2_x86_64.whl (4.2 MB view details)

Uploaded CPython 3.12musllinux: musl 1.2+ x86-64

pyopa-0.8.6-cp312-cp312-manylinux_2_17_x86_64.manylinux2014_x86_64.whl (4.2 MB view details)

Uploaded CPython 3.12manylinux: glibc 2.17+ x86-64

pyopa-0.8.6-cp312-cp312-macosx_11_0_arm64.whl (3.5 MB view details)

Uploaded CPython 3.12macOS 11.0+ ARM64

pyopa-0.8.6-cp312-cp312-macosx_10_13_x86_64.whl (3.6 MB view details)

Uploaded CPython 3.12macOS 10.13+ x86-64

pyopa-0.8.6-cp311-cp311-musllinux_1_2_x86_64.whl (4.1 MB view details)

Uploaded CPython 3.11musllinux: musl 1.2+ x86-64

pyopa-0.8.6-cp311-cp311-manylinux_2_17_x86_64.manylinux2014_x86_64.whl (4.1 MB view details)

Uploaded CPython 3.11manylinux: glibc 2.17+ x86-64

pyopa-0.8.6-cp311-cp311-macosx_11_0_arm64.whl (3.5 MB view details)

Uploaded CPython 3.11macOS 11.0+ ARM64

pyopa-0.8.6-cp311-cp311-macosx_10_9_x86_64.whl (3.6 MB view details)

Uploaded CPython 3.11macOS 10.9+ x86-64

pyopa-0.8.6-cp310-cp310-musllinux_1_2_x86_64.whl (4.1 MB view details)

Uploaded CPython 3.10musllinux: musl 1.2+ x86-64

pyopa-0.8.6-cp310-cp310-manylinux_2_17_x86_64.manylinux2014_x86_64.whl (4.1 MB view details)

Uploaded CPython 3.10manylinux: glibc 2.17+ x86-64

pyopa-0.8.6-cp310-cp310-macosx_11_0_arm64.whl (3.5 MB view details)

Uploaded CPython 3.10macOS 11.0+ ARM64

pyopa-0.8.6-cp310-cp310-macosx_10_9_x86_64.whl (3.6 MB view details)

Uploaded CPython 3.10macOS 10.9+ x86-64

pyopa-0.8.6-cp39-cp39-musllinux_1_2_x86_64.whl (4.1 MB view details)

Uploaded CPython 3.9musllinux: musl 1.2+ x86-64

pyopa-0.8.6-cp39-cp39-manylinux_2_17_x86_64.manylinux2014_x86_64.whl (4.1 MB view details)

Uploaded CPython 3.9manylinux: glibc 2.17+ x86-64

pyopa-0.8.6-cp39-cp39-macosx_11_0_arm64.whl (3.5 MB view details)

Uploaded CPython 3.9macOS 11.0+ ARM64

pyopa-0.8.6-cp39-cp39-macosx_10_9_x86_64.whl (3.6 MB view details)

Uploaded CPython 3.9macOS 10.9+ x86-64

pyopa-0.8.6-cp38-cp38-musllinux_1_2_x86_64.whl (4.2 MB view details)

Uploaded CPython 3.8musllinux: musl 1.2+ x86-64

pyopa-0.8.6-cp38-cp38-manylinux_2_17_x86_64.manylinux2014_x86_64.whl (4.1 MB view details)

Uploaded CPython 3.8manylinux: glibc 2.17+ x86-64

pyopa-0.8.6-cp38-cp38-macosx_11_0_arm64.whl (3.5 MB view details)

Uploaded CPython 3.8macOS 11.0+ ARM64

pyopa-0.8.6-cp38-cp38-macosx_10_9_x86_64.whl (3.6 MB view details)

Uploaded CPython 3.8macOS 10.9+ x86-64

pyopa-0.8.6-cp37-cp37m-musllinux_1_2_x86_64.whl (4.1 MB view details)

Uploaded CPython 3.7mmusllinux: musl 1.2+ x86-64

pyopa-0.8.6-cp37-cp37m-manylinux_2_17_x86_64.manylinux2014_x86_64.whl (4.0 MB view details)

Uploaded CPython 3.7mmanylinux: glibc 2.17+ x86-64

pyopa-0.8.6-cp37-cp37m-macosx_10_9_x86_64.whl (3.6 MB view details)

Uploaded CPython 3.7mmacOS 10.9+ x86-64

pyopa-0.8.6-cp36-cp36m-musllinux_1_2_x86_64.whl (4.0 MB view details)

Uploaded CPython 3.6mmusllinux: musl 1.2+ x86-64

pyopa-0.8.6-cp36-cp36m-manylinux_2_17_x86_64.manylinux2014_x86_64.whl (4.0 MB view details)

Uploaded CPython 3.6mmanylinux: glibc 2.17+ x86-64

pyopa-0.8.6-cp36-cp36m-macosx_10_9_x86_64.whl (3.5 MB view details)

Uploaded CPython 3.6mmacOS 10.9+ x86-64

File details

Details for the file pyopa-0.8.6.tar.gz.

File metadata

  • Download URL: pyopa-0.8.6.tar.gz
  • Upload date:
  • Size: 4.0 MB
  • Tags: Source
  • Uploaded using Trusted Publishing? Yes
  • Uploaded via: twine/6.1.0 CPython/3.12.8

File hashes

Hashes for pyopa-0.8.6.tar.gz
Algorithm Hash digest
SHA256 38afb3e4ca180b6a8bd66e1ef59e2e85efe1131f6107e20f10576b65f73fd887
MD5 dc9ed9dd17fef96159ec28aeec576de6
BLAKE2b-256 0c4f88528260a7c5fb230ed0ef82b38aa09f63bbb308bd2ff5e170151aebd8af

See more details on using hashes here.

Provenance

The following attestation bundles were made for pyopa-0.8.6.tar.gz:

Publisher: wheels.yml on DessimozLab/pyopa

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file pyopa-0.8.6-cp313-cp313-musllinux_1_2_x86_64.whl.

File metadata

File hashes

Hashes for pyopa-0.8.6-cp313-cp313-musllinux_1_2_x86_64.whl
Algorithm Hash digest
SHA256 c785593ecf29fe12b024a486c2f0ce302d339dc7925c6d7591b00f06eab9a738
MD5 e6be0d65b32221314f9f6b6e9719f24d
BLAKE2b-256 afdbed459e09840e2eb9fff5c144c813ef596ecf74436e55bf11a0f7207c628e

See more details on using hashes here.

Provenance

The following attestation bundles were made for pyopa-0.8.6-cp313-cp313-musllinux_1_2_x86_64.whl:

Publisher: wheels.yml on DessimozLab/pyopa

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file pyopa-0.8.6-cp313-cp313-manylinux_2_17_x86_64.manylinux2014_x86_64.whl.

File metadata

File hashes

Hashes for pyopa-0.8.6-cp313-cp313-manylinux_2_17_x86_64.manylinux2014_x86_64.whl
Algorithm Hash digest
SHA256 37e5f44b88907fb661f6d6f782bc62d65caf213644be5b28a44c17818d7ec146
MD5 a8a25b18910a871baba0dbd7192a2802
BLAKE2b-256 7e48a8dfb4a48104c2bd059b1ac47215f66cf0cc5a3eceb65a36a0a5152bdf45

See more details on using hashes here.

Provenance

The following attestation bundles were made for pyopa-0.8.6-cp313-cp313-manylinux_2_17_x86_64.manylinux2014_x86_64.whl:

Publisher: wheels.yml on DessimozLab/pyopa

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file pyopa-0.8.6-cp313-cp313-macosx_11_0_arm64.whl.

File metadata

File hashes

Hashes for pyopa-0.8.6-cp313-cp313-macosx_11_0_arm64.whl
Algorithm Hash digest
SHA256 3e4c34fdfed533465b10afcd7f9bf37ba7414cc6dfced30b43649ca9220b5e53
MD5 f196917c8d62c266dc63a0859294b7eb
BLAKE2b-256 3ab40d1b1e798a56b69d91a719de2c6cb48dfaf48cbbd3e4ec76e92685ec046b

See more details on using hashes here.

Provenance

The following attestation bundles were made for pyopa-0.8.6-cp313-cp313-macosx_11_0_arm64.whl:

Publisher: wheels.yml on DessimozLab/pyopa

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file pyopa-0.8.6-cp313-cp313-macosx_10_13_x86_64.whl.

File metadata

File hashes

Hashes for pyopa-0.8.6-cp313-cp313-macosx_10_13_x86_64.whl
Algorithm Hash digest
SHA256 8889dab07531ce21d6557d070fe60a1fdd7fd0edf8bb301d0c1cf960c28f1cbc
MD5 32fafa1ce63964323831731ea3bfaebf
BLAKE2b-256 f06ee3c8031126a1d066d8f59cfe159c6245a80c78a1aa59624c843559049e59

See more details on using hashes here.

Provenance

The following attestation bundles were made for pyopa-0.8.6-cp313-cp313-macosx_10_13_x86_64.whl:

Publisher: wheels.yml on DessimozLab/pyopa

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file pyopa-0.8.6-cp312-cp312-musllinux_1_2_x86_64.whl.

File metadata

File hashes

Hashes for pyopa-0.8.6-cp312-cp312-musllinux_1_2_x86_64.whl
Algorithm Hash digest
SHA256 ceb739b36e4ca0d2f465969d7f67c326ac500cd67225f42baf6dc16ea52a3598
MD5 9266bbcc3bfe901628df955b2963e0eb
BLAKE2b-256 9467f4518fdc0c79f070e0720d777525dd6ce41bc209826236f35b7925fd3add

See more details on using hashes here.

Provenance

The following attestation bundles were made for pyopa-0.8.6-cp312-cp312-musllinux_1_2_x86_64.whl:

Publisher: wheels.yml on DessimozLab/pyopa

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file pyopa-0.8.6-cp312-cp312-manylinux_2_17_x86_64.manylinux2014_x86_64.whl.

File metadata

File hashes

Hashes for pyopa-0.8.6-cp312-cp312-manylinux_2_17_x86_64.manylinux2014_x86_64.whl
Algorithm Hash digest
SHA256 443689fd98f1355fc0532f9c310fcf67e53d7380c97ea244189a4f39bbcd9d9e
MD5 e9fc3271d4dfb6a47bb5486eb033337f
BLAKE2b-256 87bfc2403e086ca44653ce386dbe105ed59117dce5db47ce6cfb7e4d790f696a

See more details on using hashes here.

Provenance

The following attestation bundles were made for pyopa-0.8.6-cp312-cp312-manylinux_2_17_x86_64.manylinux2014_x86_64.whl:

Publisher: wheels.yml on DessimozLab/pyopa

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file pyopa-0.8.6-cp312-cp312-macosx_11_0_arm64.whl.

File metadata

File hashes

Hashes for pyopa-0.8.6-cp312-cp312-macosx_11_0_arm64.whl
Algorithm Hash digest
SHA256 d945000c210a19da9b59a239152308658f200f3aeeb9da4ba004b8ff4144055f
MD5 9fabe455469104aa205211de22e5c77b
BLAKE2b-256 4975f1c2f486973647ea8c0792aa76370e1edb55ef853c30c16203680e917498

See more details on using hashes here.

Provenance

The following attestation bundles were made for pyopa-0.8.6-cp312-cp312-macosx_11_0_arm64.whl:

Publisher: wheels.yml on DessimozLab/pyopa

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file pyopa-0.8.6-cp312-cp312-macosx_10_13_x86_64.whl.

File metadata

File hashes

Hashes for pyopa-0.8.6-cp312-cp312-macosx_10_13_x86_64.whl
Algorithm Hash digest
SHA256 0901b029725594c6f60f27e40c4e62e850ccfd7242ef7b990b6b2796c8f1f0b4
MD5 8a3aee892f575e69376ff95e5acd3f37
BLAKE2b-256 920c18e385a8d131c0c6b3cf9303ca9aefdd9f9ee3d7f1d64ff1203adccd3e6f

See more details on using hashes here.

Provenance

The following attestation bundles were made for pyopa-0.8.6-cp312-cp312-macosx_10_13_x86_64.whl:

Publisher: wheels.yml on DessimozLab/pyopa

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file pyopa-0.8.6-cp311-cp311-musllinux_1_2_x86_64.whl.

File metadata

File hashes

Hashes for pyopa-0.8.6-cp311-cp311-musllinux_1_2_x86_64.whl
Algorithm Hash digest
SHA256 a133c3b6760b3197f18850d8d45e724f0a223589aa5e0c027cddf138d9223fe7
MD5 7cf2850f9f25015c2c8f56f3436299f0
BLAKE2b-256 fc6408cde0e9b5c17a498da102f62c405905ed629655ff7c71802960243be0d7

See more details on using hashes here.

Provenance

The following attestation bundles were made for pyopa-0.8.6-cp311-cp311-musllinux_1_2_x86_64.whl:

Publisher: wheels.yml on DessimozLab/pyopa

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file pyopa-0.8.6-cp311-cp311-manylinux_2_17_x86_64.manylinux2014_x86_64.whl.

File metadata

File hashes

Hashes for pyopa-0.8.6-cp311-cp311-manylinux_2_17_x86_64.manylinux2014_x86_64.whl
Algorithm Hash digest
SHA256 4d3516242c11a70bd02f25dd1a47b0e589805a02df52b81cb5d4998a85c13926
MD5 540f1db167502b16e266335899fd1e14
BLAKE2b-256 3460daaa4a8f3d46e75313568d04cd12941b7f386a3b7f98aca49525e9dede1d

See more details on using hashes here.

Provenance

The following attestation bundles were made for pyopa-0.8.6-cp311-cp311-manylinux_2_17_x86_64.manylinux2014_x86_64.whl:

Publisher: wheels.yml on DessimozLab/pyopa

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file pyopa-0.8.6-cp311-cp311-macosx_11_0_arm64.whl.

File metadata

File hashes

Hashes for pyopa-0.8.6-cp311-cp311-macosx_11_0_arm64.whl
Algorithm Hash digest
SHA256 c361e7eaf9199b17779562f2947c9f6e88b4b91b4e34d0b960c0f77b14a21eee
MD5 071bd4c3a384dd1cc2ebe76ffdb19772
BLAKE2b-256 769962e5a0ebaa0de337119c384be434d5c80e18f7551f093f104d17485241c5

See more details on using hashes here.

Provenance

The following attestation bundles were made for pyopa-0.8.6-cp311-cp311-macosx_11_0_arm64.whl:

Publisher: wheels.yml on DessimozLab/pyopa

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file pyopa-0.8.6-cp311-cp311-macosx_10_9_x86_64.whl.

File metadata

File hashes

Hashes for pyopa-0.8.6-cp311-cp311-macosx_10_9_x86_64.whl
Algorithm Hash digest
SHA256 762bbdad9a1d908c8a61aab5d51866e1a7ff4cd0cf0627482b72137b9b852ad8
MD5 bcdf89b382325a619a1848fd621d3dce
BLAKE2b-256 b5ad41f15c10fad878d3c1734dfb585b678142893d3717c58ecd1985a5127d2d

See more details on using hashes here.

Provenance

The following attestation bundles were made for pyopa-0.8.6-cp311-cp311-macosx_10_9_x86_64.whl:

Publisher: wheels.yml on DessimozLab/pyopa

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file pyopa-0.8.6-cp310-cp310-musllinux_1_2_x86_64.whl.

File metadata

File hashes

Hashes for pyopa-0.8.6-cp310-cp310-musllinux_1_2_x86_64.whl
Algorithm Hash digest
SHA256 af20f315ebd5692dfc8e42191af9f1c41818b798fc10f23402e4cd95ef417789
MD5 4ddb486bfd9fab184accc2023696500d
BLAKE2b-256 4afc8849d5aab7d8faf3fd4174651649cc1429d91aec058f6651e42cbe776eb4

See more details on using hashes here.

Provenance

The following attestation bundles were made for pyopa-0.8.6-cp310-cp310-musllinux_1_2_x86_64.whl:

Publisher: wheels.yml on DessimozLab/pyopa

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file pyopa-0.8.6-cp310-cp310-manylinux_2_17_x86_64.manylinux2014_x86_64.whl.

File metadata

File hashes

Hashes for pyopa-0.8.6-cp310-cp310-manylinux_2_17_x86_64.manylinux2014_x86_64.whl
Algorithm Hash digest
SHA256 9dccdc2f1e252fb2798b43fde821343225d774d49f78bcf948c8a6c99ee67f04
MD5 6690f4d667f37e9614edd9b5b7d74abb
BLAKE2b-256 ba7015837c5ecc87ec00efc9c44ac5d3a20295a7ca6884d0fac96017dd952369

See more details on using hashes here.

Provenance

The following attestation bundles were made for pyopa-0.8.6-cp310-cp310-manylinux_2_17_x86_64.manylinux2014_x86_64.whl:

Publisher: wheels.yml on DessimozLab/pyopa

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file pyopa-0.8.6-cp310-cp310-macosx_11_0_arm64.whl.

File metadata

File hashes

Hashes for pyopa-0.8.6-cp310-cp310-macosx_11_0_arm64.whl
Algorithm Hash digest
SHA256 b144e3538e4eca7dbc579bcd538fa56cc5c88265dc15213f176e997b8f068e0d
MD5 152d9fd76cfb0f8dcf19e19704ecbea7
BLAKE2b-256 a885efe1ad2fc16de01793a3d87eaa816cc6df66a439505dd7d57dbc3c923b46

See more details on using hashes here.

Provenance

The following attestation bundles were made for pyopa-0.8.6-cp310-cp310-macosx_11_0_arm64.whl:

Publisher: wheels.yml on DessimozLab/pyopa

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file pyopa-0.8.6-cp310-cp310-macosx_10_9_x86_64.whl.

File metadata

File hashes

Hashes for pyopa-0.8.6-cp310-cp310-macosx_10_9_x86_64.whl
Algorithm Hash digest
SHA256 7f7161f34f282fb7873189fa18e07f6c2cbe8eebbf2a8e776ca5583544371a55
MD5 621745eb302a89029dc3a73ae229a756
BLAKE2b-256 3debe316b05f41cd6548db843e75eae42f80da1ca84faf778ef710e81b0b21b0

See more details on using hashes here.

Provenance

The following attestation bundles were made for pyopa-0.8.6-cp310-cp310-macosx_10_9_x86_64.whl:

Publisher: wheels.yml on DessimozLab/pyopa

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file pyopa-0.8.6-cp39-cp39-musllinux_1_2_x86_64.whl.

File metadata

File hashes

Hashes for pyopa-0.8.6-cp39-cp39-musllinux_1_2_x86_64.whl
Algorithm Hash digest
SHA256 3be3e984c844421f4e622c79bd4d8c4fee8a35dbed19dae4d73a5815e7a22d38
MD5 485778dd727724b5a47ff84d0f9b15b3
BLAKE2b-256 02bde3ad2f715e1df9ce585f0502166875698c122d1b90d02fbd1ade57651995

See more details on using hashes here.

Provenance

The following attestation bundles were made for pyopa-0.8.6-cp39-cp39-musllinux_1_2_x86_64.whl:

Publisher: wheels.yml on DessimozLab/pyopa

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file pyopa-0.8.6-cp39-cp39-manylinux_2_17_x86_64.manylinux2014_x86_64.whl.

File metadata

File hashes

Hashes for pyopa-0.8.6-cp39-cp39-manylinux_2_17_x86_64.manylinux2014_x86_64.whl
Algorithm Hash digest
SHA256 7804549b533da94a2c7ffa8f098babfb562c2c3990cba0c12577c47e9df097eb
MD5 006c898fa978fc23c88c7a1f1f0f6d94
BLAKE2b-256 41039ee5cbfe8eb83e6538b39887bb28744e184186bb42c81f944e4b4ace2fae

See more details on using hashes here.

Provenance

The following attestation bundles were made for pyopa-0.8.6-cp39-cp39-manylinux_2_17_x86_64.manylinux2014_x86_64.whl:

Publisher: wheels.yml on DessimozLab/pyopa

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file pyopa-0.8.6-cp39-cp39-macosx_11_0_arm64.whl.

File metadata

  • Download URL: pyopa-0.8.6-cp39-cp39-macosx_11_0_arm64.whl
  • Upload date:
  • Size: 3.5 MB
  • Tags: CPython 3.9, macOS 11.0+ ARM64
  • Uploaded using Trusted Publishing? Yes
  • Uploaded via: twine/6.1.0 CPython/3.12.8

File hashes

Hashes for pyopa-0.8.6-cp39-cp39-macosx_11_0_arm64.whl
Algorithm Hash digest
SHA256 42b1c0756e5e4c3dbee49acb01f9b7f2700f012a2d2f2d93536ad55c4cd4acab
MD5 be2adefcc5a702d444204c10f7ff211f
BLAKE2b-256 4b3794d455ccd192ce7637452ea84b9fe752445ca2224bb3fd91b88988f4004d

See more details on using hashes here.

Provenance

The following attestation bundles were made for pyopa-0.8.6-cp39-cp39-macosx_11_0_arm64.whl:

Publisher: wheels.yml on DessimozLab/pyopa

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file pyopa-0.8.6-cp39-cp39-macosx_10_9_x86_64.whl.

File metadata

File hashes

Hashes for pyopa-0.8.6-cp39-cp39-macosx_10_9_x86_64.whl
Algorithm Hash digest
SHA256 10af68b2a368496e2bc24d7a5fb63870f4190d12a1aa2722ef59642ee80eaa82
MD5 3a8b4a1bf3fc71aa7ea4285ff35cfea1
BLAKE2b-256 441aadb8c6de9d07609b413dcc42fc66366ab53690f8dc459a1e0bdd068925cd

See more details on using hashes here.

Provenance

The following attestation bundles were made for pyopa-0.8.6-cp39-cp39-macosx_10_9_x86_64.whl:

Publisher: wheels.yml on DessimozLab/pyopa

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file pyopa-0.8.6-cp38-cp38-musllinux_1_2_x86_64.whl.

File metadata

File hashes

Hashes for pyopa-0.8.6-cp38-cp38-musllinux_1_2_x86_64.whl
Algorithm Hash digest
SHA256 697e1e4726d6fb2173c845a1363eb8c0195df5cb035d95bbe884ae47675dae93
MD5 a0d9f9133b8d451a2387b1a4fed6dce6
BLAKE2b-256 0316ab9f815b6657947fcf1bfbe2e1705875ac9274a6b04b9c6c91fc152d952a

See more details on using hashes here.

Provenance

The following attestation bundles were made for pyopa-0.8.6-cp38-cp38-musllinux_1_2_x86_64.whl:

Publisher: wheels.yml on DessimozLab/pyopa

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file pyopa-0.8.6-cp38-cp38-manylinux_2_17_x86_64.manylinux2014_x86_64.whl.

File metadata

File hashes

Hashes for pyopa-0.8.6-cp38-cp38-manylinux_2_17_x86_64.manylinux2014_x86_64.whl
Algorithm Hash digest
SHA256 7c9598307c2ff2f28fd7a5729ed318177483bd1aa75d7e3b7549645ba991a7ad
MD5 814ea36d5fafc4a5bace9bd29f9f1cba
BLAKE2b-256 6708cc298be08092ed3a0a243a9801c3e977a97cf1707f389b082221bdd3c488

See more details on using hashes here.

Provenance

The following attestation bundles were made for pyopa-0.8.6-cp38-cp38-manylinux_2_17_x86_64.manylinux2014_x86_64.whl:

Publisher: wheels.yml on DessimozLab/pyopa

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file pyopa-0.8.6-cp38-cp38-macosx_11_0_arm64.whl.

File metadata

  • Download URL: pyopa-0.8.6-cp38-cp38-macosx_11_0_arm64.whl
  • Upload date:
  • Size: 3.5 MB
  • Tags: CPython 3.8, macOS 11.0+ ARM64
  • Uploaded using Trusted Publishing? Yes
  • Uploaded via: twine/6.1.0 CPython/3.12.8

File hashes

Hashes for pyopa-0.8.6-cp38-cp38-macosx_11_0_arm64.whl
Algorithm Hash digest
SHA256 7f9fe9fa3c3ec388a03be160b2dd4155d918548dfb8863ad7d8511176bff0cef
MD5 d0f323b491e4b4d58678df7d1f075186
BLAKE2b-256 5d384985d443eb09bed7b942535e9eea052f6726c0fafa23c595d9b2413cc942

See more details on using hashes here.

Provenance

The following attestation bundles were made for pyopa-0.8.6-cp38-cp38-macosx_11_0_arm64.whl:

Publisher: wheels.yml on DessimozLab/pyopa

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file pyopa-0.8.6-cp38-cp38-macosx_10_9_x86_64.whl.

File metadata

File hashes

Hashes for pyopa-0.8.6-cp38-cp38-macosx_10_9_x86_64.whl
Algorithm Hash digest
SHA256 52f028eee90f0680c97530c78f6c0cabc81201758e1cf86b0df4b01297359a49
MD5 10387956fc579c138ad197cdb6d9ae3f
BLAKE2b-256 1bcaec3d0efc9ee89e5515c383092ba718ea31b344c968fb732298d88fb301c3

See more details on using hashes here.

Provenance

The following attestation bundles were made for pyopa-0.8.6-cp38-cp38-macosx_10_9_x86_64.whl:

Publisher: wheels.yml on DessimozLab/pyopa

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file pyopa-0.8.6-cp37-cp37m-musllinux_1_2_x86_64.whl.

File metadata

File hashes

Hashes for pyopa-0.8.6-cp37-cp37m-musllinux_1_2_x86_64.whl
Algorithm Hash digest
SHA256 6ca13588fd4bdef46ccb3efe7f1eb329c6a2a2844a8281f8c47a7600fc18dc65
MD5 782d40a9227a4e7d36becda6db2f161c
BLAKE2b-256 827eaea2c0802554b1065a8f61e27abe48903e06d96b567f958d2097982c0c9a

See more details on using hashes here.

Provenance

The following attestation bundles were made for pyopa-0.8.6-cp37-cp37m-musllinux_1_2_x86_64.whl:

Publisher: wheels.yml on DessimozLab/pyopa

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file pyopa-0.8.6-cp37-cp37m-manylinux_2_17_x86_64.manylinux2014_x86_64.whl.

File metadata

File hashes

Hashes for pyopa-0.8.6-cp37-cp37m-manylinux_2_17_x86_64.manylinux2014_x86_64.whl
Algorithm Hash digest
SHA256 f3298956bf012998b1eb52e72352c6bc382ab4b687e4f34c9a685d056c362bb2
MD5 3220dbe9142e5631a9a6d4af86aa9111
BLAKE2b-256 90daafdf4412a7e4808e2cf077f789eeaed12bf11d51f1023a5b9e65d9eafdfd

See more details on using hashes here.

Provenance

The following attestation bundles were made for pyopa-0.8.6-cp37-cp37m-manylinux_2_17_x86_64.manylinux2014_x86_64.whl:

Publisher: wheels.yml on DessimozLab/pyopa

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file pyopa-0.8.6-cp37-cp37m-macosx_10_9_x86_64.whl.

File metadata

File hashes

Hashes for pyopa-0.8.6-cp37-cp37m-macosx_10_9_x86_64.whl
Algorithm Hash digest
SHA256 5a0dd04d6f7796ba7edb81ecbf09a9c085010f8de1716b3bd6e2a835adb1fff5
MD5 2e152b3eb8ecdc27b9955e2c53a217b9
BLAKE2b-256 1644d06c08064dabaf10354c913b93eb575ddd3b42ab34511f53ddff99811bcb

See more details on using hashes here.

Provenance

The following attestation bundles were made for pyopa-0.8.6-cp37-cp37m-macosx_10_9_x86_64.whl:

Publisher: wheels.yml on DessimozLab/pyopa

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file pyopa-0.8.6-cp36-cp36m-musllinux_1_2_x86_64.whl.

File metadata

File hashes

Hashes for pyopa-0.8.6-cp36-cp36m-musllinux_1_2_x86_64.whl
Algorithm Hash digest
SHA256 847408adc4f2f3f1780cfdda551cc734bf782178880f7f97c3a13a1c2e9d85f3
MD5 6984e82bd23572e106dee73ac06d9d37
BLAKE2b-256 1cfe4ef9733bd71e391ecc80d22f21334a05f400ce29cb21584bb58297c61f68

See more details on using hashes here.

Provenance

The following attestation bundles were made for pyopa-0.8.6-cp36-cp36m-musllinux_1_2_x86_64.whl:

Publisher: wheels.yml on DessimozLab/pyopa

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file pyopa-0.8.6-cp36-cp36m-manylinux_2_17_x86_64.manylinux2014_x86_64.whl.

File metadata

File hashes

Hashes for pyopa-0.8.6-cp36-cp36m-manylinux_2_17_x86_64.manylinux2014_x86_64.whl
Algorithm Hash digest
SHA256 0c211c7fb3dac6dcada7c6c2d406c13fb216a56273e4e2d021f7f86363833453
MD5 d2112c8c17ecb21950e16c917a7a767e
BLAKE2b-256 a390c4c5c98f079f5747707fd077f0856add96a69b58b9ad7d7145948dfb90dd

See more details on using hashes here.

Provenance

The following attestation bundles were made for pyopa-0.8.6-cp36-cp36m-manylinux_2_17_x86_64.manylinux2014_x86_64.whl:

Publisher: wheels.yml on DessimozLab/pyopa

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file pyopa-0.8.6-cp36-cp36m-macosx_10_9_x86_64.whl.

File metadata

File hashes

Hashes for pyopa-0.8.6-cp36-cp36m-macosx_10_9_x86_64.whl
Algorithm Hash digest
SHA256 933f7fdc3361e29eec9c432d11da2b824e95cab8c9ec1650d021654d5bd06ca2
MD5 c1e6a8e46c76058a37e43d559d56e053
BLAKE2b-256 efdc69b91cf6c06e223d69365f34da1a066d7d794f84e0c6cb9fd2822e30ca21

See more details on using hashes here.

Provenance

The following attestation bundles were made for pyopa-0.8.6-cp36-cp36m-macosx_10_9_x86_64.whl:

Publisher: wheels.yml on DessimozLab/pyopa

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

Supported by

AWS Cloud computing and Security Sponsor Datadog Monitoring Depot Continuous Integration Fastly CDN Google Download Analytics Sentry Error logging StatusPage Status page