This python package provides a fast implementation to compute
optimal pairwise alignments of molecular sequences
ML distance estimates of pairwise alignments.
The implementation uses Farrar’s algorithm <http://bioinformatics.oxfordjournals.org/content/23/2/156.abstract>_ to compute the optimal pairwise alignment using SSE vectorization operations. This package implements the Smith-Waterman and Needleman-Wunsch algorithm to compute the local and global sequence alignments.
Installation
You can install the package using pip:
pip install pyopaWe provide wheels for Linux, MacOS (x86_64) and (arm64) for cpython.
Example
import pyopa
log_pam1_env = pyopa.read_env_json(os.path.join(pyopa.matrix_dir(), 'logPAM1.json'))
s1 = pyopa.Sequence('GCANLVSRLENNSRLLNRDLIAVKINADVYKDPNAGALRL')
s2 = pyopa.Sequence('GCANPSTLETNSQLVNRELIAVKINPRVYKGPNLGAFRL')
# super fast check whether the alignment reaches a given min-score
min_score = 100
pam250_env = pyopa.generate_env(log_pam1_env, 250, min_score)
pyopa.align_short(s1, s2, pam250_env)1 maintainer
Metadata
1 maintainer
Release files for pyopa 0.8.6
For a detailed explanation of source distributions (sdists) and built distributions (wheels), please see the package formats documentation.
Source distribution (sdist)
| File | Size | Uploaded | |
|---|---|---|---|
| pyopa-0.8.6.tar.gz | 4.0 MB | Details |
Built distributions (wheels)
Total release size: 119.3 MB
Release files / pyopa-0.8.6.tar.gz
| Download URL | pyopa-0.8.6.tar.gz |
|---|---|
| Size | 4.0 MB |
| Tags | Source |
|
SHA-256 checksum How to use checksums |
38afb3e4ca180b6a8bd66e1ef59e2e85efe1131f6107e20f10576b65f73fd887
|
|
BLAKE2b-256 checksum How to use checksums |
0c4f88528260a7c5fb230ed0ef82b38aa09f63bbb308bd2ff5e170151aebd8af
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.12.8
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Apr 24, 2025.
Transparency logRelease files / pyopa-0.8.6-cp313-cp313-musllinux_1_2_x86_64.whl
| Download URL | pyopa-0.8.6-cp313-cp313-musllinux_1_2_x86_64.whl |
|---|---|
| Size | 4.2 MB |
| Tags | CPython 3.13 Linux musl 1.2+ x86-64 |
|
SHA-256 checksum How to use checksums |
c785593ecf29fe12b024a486c2f0ce302d339dc7925c6d7591b00f06eab9a738
|
|
BLAKE2b-256 checksum How to use checksums |
afdbed459e09840e2eb9fff5c144c813ef596ecf74436e55bf11a0f7207c628e
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.12.8
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Apr 24, 2025.
Transparency logRelease files / pyopa-0.8.6-cp313-cp313-manylinux_2_17_x86_64.manylinux2014_x86_64.whl
| Download URL | pyopa-0.8.6-cp313-cp313-manylinux_2_17_x86_64.manylinux2014_x86_64.whl |
|---|---|
| Size | 4.1 MB |
| Tags | CPython 3.13 Linux glibc 2.17+ x86-64 |
|
SHA-256 checksum How to use checksums |
37e5f44b88907fb661f6d6f782bc62d65caf213644be5b28a44c17818d7ec146
|
|
BLAKE2b-256 checksum How to use checksums |
7e48a8dfb4a48104c2bd059b1ac47215f66cf0cc5a3eceb65a36a0a5152bdf45
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.12.8
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Apr 24, 2025.
Transparency logRelease files / pyopa-0.8.6-cp313-cp313-macosx_11_0_arm64.whl
| Download URL | pyopa-0.8.6-cp313-cp313-macosx_11_0_arm64.whl |
|---|---|
| Size | 3.5 MB |
| Tags | CPython 3.13 macOS 11.0+ ARM64 |
|
SHA-256 checksum How to use checksums |
3e4c34fdfed533465b10afcd7f9bf37ba7414cc6dfced30b43649ca9220b5e53
|
|
BLAKE2b-256 checksum How to use checksums |
3ab40d1b1e798a56b69d91a719de2c6cb48dfaf48cbbd3e4ec76e92685ec046b
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.12.8
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Apr 24, 2025.
Transparency logRelease files / pyopa-0.8.6-cp313-cp313-macosx_10_13_x86_64.whl
| Download URL | pyopa-0.8.6-cp313-cp313-macosx_10_13_x86_64.whl |
|---|---|
| Size | 3.6 MB |
| Tags | CPython 3.13 macOS 10.13+ x86-64 |
|
SHA-256 checksum How to use checksums |
8889dab07531ce21d6557d070fe60a1fdd7fd0edf8bb301d0c1cf960c28f1cbc
|
|
BLAKE2b-256 checksum How to use checksums |
f06ee3c8031126a1d066d8f59cfe159c6245a80c78a1aa59624c843559049e59
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.12.8
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Apr 24, 2025.
Transparency logRelease files / pyopa-0.8.6-cp312-cp312-musllinux_1_2_x86_64.whl
| Download URL | pyopa-0.8.6-cp312-cp312-musllinux_1_2_x86_64.whl |
|---|---|
| Size | 4.2 MB |
| Tags | CPython 3.12 Linux musl 1.2+ x86-64 |
|
SHA-256 checksum How to use checksums |
ceb739b36e4ca0d2f465969d7f67c326ac500cd67225f42baf6dc16ea52a3598
|
|
BLAKE2b-256 checksum How to use checksums |
9467f4518fdc0c79f070e0720d777525dd6ce41bc209826236f35b7925fd3add
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.12.8
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Apr 24, 2025.
Transparency logRelease files / pyopa-0.8.6-cp312-cp312-manylinux_2_17_x86_64.manylinux2014_x86_64.whl
| Download URL | pyopa-0.8.6-cp312-cp312-manylinux_2_17_x86_64.manylinux2014_x86_64.whl |
|---|---|
| Size | 4.2 MB |
| Tags | CPython 3.12 Linux glibc 2.17+ x86-64 |
|
SHA-256 checksum How to use checksums |
443689fd98f1355fc0532f9c310fcf67e53d7380c97ea244189a4f39bbcd9d9e
|
|
BLAKE2b-256 checksum How to use checksums |
87bfc2403e086ca44653ce386dbe105ed59117dce5db47ce6cfb7e4d790f696a
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.12.8
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Apr 24, 2025.
Transparency logRelease files / pyopa-0.8.6-cp312-cp312-macosx_11_0_arm64.whl
| Download URL | pyopa-0.8.6-cp312-cp312-macosx_11_0_arm64.whl |
|---|---|
| Size | 3.5 MB |
| Tags | CPython 3.12 macOS 11.0+ ARM64 |
|
SHA-256 checksum How to use checksums |
d945000c210a19da9b59a239152308658f200f3aeeb9da4ba004b8ff4144055f
|
|
BLAKE2b-256 checksum How to use checksums |
4975f1c2f486973647ea8c0792aa76370e1edb55ef853c30c16203680e917498
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.12.8
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Apr 24, 2025.
Transparency logRelease files / pyopa-0.8.6-cp312-cp312-macosx_10_13_x86_64.whl
| Download URL | pyopa-0.8.6-cp312-cp312-macosx_10_13_x86_64.whl |
|---|---|
| Size | 3.6 MB |
| Tags | CPython 3.12 macOS 10.13+ x86-64 |
|
SHA-256 checksum How to use checksums |
0901b029725594c6f60f27e40c4e62e850ccfd7242ef7b990b6b2796c8f1f0b4
|
|
BLAKE2b-256 checksum How to use checksums |
920c18e385a8d131c0c6b3cf9303ca9aefdd9f9ee3d7f1d64ff1203adccd3e6f
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.12.8
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Apr 24, 2025.
Transparency logRelease files / pyopa-0.8.6-cp311-cp311-musllinux_1_2_x86_64.whl
| Download URL | pyopa-0.8.6-cp311-cp311-musllinux_1_2_x86_64.whl |
|---|---|
| Size | 4.1 MB |
| Tags | CPython 3.11 Linux musl 1.2+ x86-64 |
|
SHA-256 checksum How to use checksums |
a133c3b6760b3197f18850d8d45e724f0a223589aa5e0c027cddf138d9223fe7
|
|
BLAKE2b-256 checksum How to use checksums |
fc6408cde0e9b5c17a498da102f62c405905ed629655ff7c71802960243be0d7
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.12.8
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Apr 24, 2025.
Transparency logRelease files / pyopa-0.8.6-cp311-cp311-manylinux_2_17_x86_64.manylinux2014_x86_64.whl
| Download URL | pyopa-0.8.6-cp311-cp311-manylinux_2_17_x86_64.manylinux2014_x86_64.whl |
|---|---|
| Size | 4.1 MB |
| Tags | CPython 3.11 Linux glibc 2.17+ x86-64 |
|
SHA-256 checksum How to use checksums |
4d3516242c11a70bd02f25dd1a47b0e589805a02df52b81cb5d4998a85c13926
|
|
BLAKE2b-256 checksum How to use checksums |
3460daaa4a8f3d46e75313568d04cd12941b7f386a3b7f98aca49525e9dede1d
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.12.8
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Apr 24, 2025.
Transparency logRelease files / pyopa-0.8.6-cp311-cp311-macosx_11_0_arm64.whl
| Download URL | pyopa-0.8.6-cp311-cp311-macosx_11_0_arm64.whl |
|---|---|
| Size | 3.5 MB |
| Tags | CPython 3.11 macOS 11.0+ ARM64 |
|
SHA-256 checksum How to use checksums |
c361e7eaf9199b17779562f2947c9f6e88b4b91b4e34d0b960c0f77b14a21eee
|
|
BLAKE2b-256 checksum How to use checksums |
769962e5a0ebaa0de337119c384be434d5c80e18f7551f093f104d17485241c5
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.12.8
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Apr 24, 2025.
Transparency logRelease files / pyopa-0.8.6-cp311-cp311-macosx_10_9_x86_64.whl
| Download URL | pyopa-0.8.6-cp311-cp311-macosx_10_9_x86_64.whl |
|---|---|
| Size | 3.6 MB |
| Tags | CPython 3.11 macOS 10.9+ x86-64 |
|
SHA-256 checksum How to use checksums |
762bbdad9a1d908c8a61aab5d51866e1a7ff4cd0cf0627482b72137b9b852ad8
|
|
BLAKE2b-256 checksum How to use checksums |
b5ad41f15c10fad878d3c1734dfb585b678142893d3717c58ecd1985a5127d2d
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.12.8
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Apr 24, 2025.
Transparency logRelease files / pyopa-0.8.6-cp310-cp310-musllinux_1_2_x86_64.whl
| Download URL | pyopa-0.8.6-cp310-cp310-musllinux_1_2_x86_64.whl |
|---|---|
| Size | 4.1 MB |
| Tags | CPython 3.10 Linux musl 1.2+ x86-64 |
|
SHA-256 checksum How to use checksums |
af20f315ebd5692dfc8e42191af9f1c41818b798fc10f23402e4cd95ef417789
|
|
BLAKE2b-256 checksum How to use checksums |
4afc8849d5aab7d8faf3fd4174651649cc1429d91aec058f6651e42cbe776eb4
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.12.8
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Apr 24, 2025.
Transparency logRelease files / pyopa-0.8.6-cp310-cp310-manylinux_2_17_x86_64.manylinux2014_x86_64.whl
| Download URL | pyopa-0.8.6-cp310-cp310-manylinux_2_17_x86_64.manylinux2014_x86_64.whl |
|---|---|
| Size | 4.1 MB |
| Tags | CPython 3.10 Linux glibc 2.17+ x86-64 |
|
SHA-256 checksum How to use checksums |
9dccdc2f1e252fb2798b43fde821343225d774d49f78bcf948c8a6c99ee67f04
|
|
BLAKE2b-256 checksum How to use checksums |
ba7015837c5ecc87ec00efc9c44ac5d3a20295a7ca6884d0fac96017dd952369
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.12.8
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Apr 24, 2025.
Transparency logRelease files / pyopa-0.8.6-cp310-cp310-macosx_11_0_arm64.whl
| Download URL | pyopa-0.8.6-cp310-cp310-macosx_11_0_arm64.whl |
|---|---|
| Size | 3.5 MB |
| Tags | CPython 3.10 macOS 11.0+ ARM64 |
|
SHA-256 checksum How to use checksums |
b144e3538e4eca7dbc579bcd538fa56cc5c88265dc15213f176e997b8f068e0d
|
|
BLAKE2b-256 checksum How to use checksums |
a885efe1ad2fc16de01793a3d87eaa816cc6df66a439505dd7d57dbc3c923b46
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.12.8
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Apr 24, 2025.
Transparency logRelease files / pyopa-0.8.6-cp310-cp310-macosx_10_9_x86_64.whl
| Download URL | pyopa-0.8.6-cp310-cp310-macosx_10_9_x86_64.whl |
|---|---|
| Size | 3.6 MB |
| Tags | CPython 3.10 macOS 10.9+ x86-64 |
|
SHA-256 checksum How to use checksums |
7f7161f34f282fb7873189fa18e07f6c2cbe8eebbf2a8e776ca5583544371a55
|
|
BLAKE2b-256 checksum How to use checksums |
3debe316b05f41cd6548db843e75eae42f80da1ca84faf778ef710e81b0b21b0
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.12.8
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Apr 24, 2025.
Transparency logRelease files / pyopa-0.8.6-cp39-cp39-musllinux_1_2_x86_64.whl
| Download URL | pyopa-0.8.6-cp39-cp39-musllinux_1_2_x86_64.whl |
|---|---|
| Size | 4.1 MB |
| Tags | CPython 3.9 Linux musl 1.2+ x86-64 |
|
SHA-256 checksum How to use checksums |
3be3e984c844421f4e622c79bd4d8c4fee8a35dbed19dae4d73a5815e7a22d38
|
|
BLAKE2b-256 checksum How to use checksums |
02bde3ad2f715e1df9ce585f0502166875698c122d1b90d02fbd1ade57651995
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.12.8
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Apr 24, 2025.
Transparency logRelease files / pyopa-0.8.6-cp39-cp39-manylinux_2_17_x86_64.manylinux2014_x86_64.whl
| Download URL | pyopa-0.8.6-cp39-cp39-manylinux_2_17_x86_64.manylinux2014_x86_64.whl |
|---|---|
| Size | 4.1 MB |
| Tags | CPython 3.9 Linux glibc 2.17+ x86-64 |
|
SHA-256 checksum How to use checksums |
7804549b533da94a2c7ffa8f098babfb562c2c3990cba0c12577c47e9df097eb
|
|
BLAKE2b-256 checksum How to use checksums |
41039ee5cbfe8eb83e6538b39887bb28744e184186bb42c81f944e4b4ace2fae
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.12.8
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Apr 24, 2025.
Transparency logRelease files / pyopa-0.8.6-cp39-cp39-macosx_11_0_arm64.whl
| Download URL | pyopa-0.8.6-cp39-cp39-macosx_11_0_arm64.whl |
|---|---|
| Size | 3.5 MB |
| Tags | CPython 3.9 macOS 11.0+ ARM64 |
|
SHA-256 checksum How to use checksums |
42b1c0756e5e4c3dbee49acb01f9b7f2700f012a2d2f2d93536ad55c4cd4acab
|
|
BLAKE2b-256 checksum How to use checksums |
4b3794d455ccd192ce7637452ea84b9fe752445ca2224bb3fd91b88988f4004d
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.12.8
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Apr 24, 2025.
Transparency logRelease files / pyopa-0.8.6-cp39-cp39-macosx_10_9_x86_64.whl
| Download URL | pyopa-0.8.6-cp39-cp39-macosx_10_9_x86_64.whl |
|---|---|
| Size | 3.6 MB |
| Tags | CPython 3.9 macOS 10.9+ x86-64 |
|
SHA-256 checksum How to use checksums |
10af68b2a368496e2bc24d7a5fb63870f4190d12a1aa2722ef59642ee80eaa82
|
|
BLAKE2b-256 checksum How to use checksums |
441aadb8c6de9d07609b413dcc42fc66366ab53690f8dc459a1e0bdd068925cd
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.12.8
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Apr 24, 2025.
Transparency logRelease files / pyopa-0.8.6-cp38-cp38-musllinux_1_2_x86_64.whl
| Download URL | pyopa-0.8.6-cp38-cp38-musllinux_1_2_x86_64.whl |
|---|---|
| Size | 4.2 MB |
| Tags | CPython 3.8 Linux musl 1.2+ x86-64 |
|
SHA-256 checksum How to use checksums |
697e1e4726d6fb2173c845a1363eb8c0195df5cb035d95bbe884ae47675dae93
|
|
BLAKE2b-256 checksum How to use checksums |
0316ab9f815b6657947fcf1bfbe2e1705875ac9274a6b04b9c6c91fc152d952a
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.12.8
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Apr 24, 2025.
Transparency logRelease files / pyopa-0.8.6-cp38-cp38-manylinux_2_17_x86_64.manylinux2014_x86_64.whl
| Download URL | pyopa-0.8.6-cp38-cp38-manylinux_2_17_x86_64.manylinux2014_x86_64.whl |
|---|---|
| Size | 4.1 MB |
| Tags | CPython 3.8 Linux glibc 2.17+ x86-64 |
|
SHA-256 checksum How to use checksums |
7c9598307c2ff2f28fd7a5729ed318177483bd1aa75d7e3b7549645ba991a7ad
|
|
BLAKE2b-256 checksum How to use checksums |
6708cc298be08092ed3a0a243a9801c3e977a97cf1707f389b082221bdd3c488
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.12.8
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Apr 24, 2025.
Transparency logRelease files / pyopa-0.8.6-cp38-cp38-macosx_11_0_arm64.whl
| Download URL | pyopa-0.8.6-cp38-cp38-macosx_11_0_arm64.whl |
|---|---|
| Size | 3.5 MB |
| Tags | CPython 3.8 macOS 11.0+ ARM64 |
|
SHA-256 checksum How to use checksums |
7f9fe9fa3c3ec388a03be160b2dd4155d918548dfb8863ad7d8511176bff0cef
|
|
BLAKE2b-256 checksum How to use checksums |
5d384985d443eb09bed7b942535e9eea052f6726c0fafa23c595d9b2413cc942
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.12.8
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Apr 24, 2025.
Transparency logRelease files / pyopa-0.8.6-cp38-cp38-macosx_10_9_x86_64.whl
| Download URL | pyopa-0.8.6-cp38-cp38-macosx_10_9_x86_64.whl |
|---|---|
| Size | 3.6 MB |
| Tags | CPython 3.8 macOS 10.9+ x86-64 |
|
SHA-256 checksum How to use checksums |
52f028eee90f0680c97530c78f6c0cabc81201758e1cf86b0df4b01297359a49
|
|
BLAKE2b-256 checksum How to use checksums |
1bcaec3d0efc9ee89e5515c383092ba718ea31b344c968fb732298d88fb301c3
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.12.8
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Apr 24, 2025.
Transparency logRelease files / pyopa-0.8.6-cp37-cp37m-musllinux_1_2_x86_64.whl
| Download URL | pyopa-0.8.6-cp37-cp37m-musllinux_1_2_x86_64.whl |
|---|---|
| Size | 4.1 MB |
| Tags | CPython 3.7 CPython 3.7 pymalloc Linux musl 1.2+ x86-64 |
|
SHA-256 checksum How to use checksums |
6ca13588fd4bdef46ccb3efe7f1eb329c6a2a2844a8281f8c47a7600fc18dc65
|
|
BLAKE2b-256 checksum How to use checksums |
827eaea2c0802554b1065a8f61e27abe48903e06d96b567f958d2097982c0c9a
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.12.8
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Apr 24, 2025.
Transparency logRelease files / pyopa-0.8.6-cp37-cp37m-manylinux_2_17_x86_64.manylinux2014_x86_64.whl
| Download URL | pyopa-0.8.6-cp37-cp37m-manylinux_2_17_x86_64.manylinux2014_x86_64.whl |
|---|---|
| Size | 4.0 MB |
| Tags | CPython 3.7 CPython 3.7 pymalloc Linux glibc 2.17+ x86-64 |
|
SHA-256 checksum How to use checksums |
f3298956bf012998b1eb52e72352c6bc382ab4b687e4f34c9a685d056c362bb2
|
|
BLAKE2b-256 checksum How to use checksums |
90daafdf4412a7e4808e2cf077f789eeaed12bf11d51f1023a5b9e65d9eafdfd
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.12.8
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Apr 24, 2025.
Transparency logRelease files / pyopa-0.8.6-cp37-cp37m-macosx_10_9_x86_64.whl
| Download URL | pyopa-0.8.6-cp37-cp37m-macosx_10_9_x86_64.whl |
|---|---|
| Size | 3.6 MB |
| Tags | CPython 3.7 CPython 3.7 pymalloc macOS 10.9+ x86-64 |
|
SHA-256 checksum How to use checksums |
5a0dd04d6f7796ba7edb81ecbf09a9c085010f8de1716b3bd6e2a835adb1fff5
|
|
BLAKE2b-256 checksum How to use checksums |
1644d06c08064dabaf10354c913b93eb575ddd3b42ab34511f53ddff99811bcb
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.12.8
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Apr 24, 2025.
Transparency logRelease files / pyopa-0.8.6-cp36-cp36m-musllinux_1_2_x86_64.whl
| Download URL | pyopa-0.8.6-cp36-cp36m-musllinux_1_2_x86_64.whl |
|---|---|
| Size | 4.0 MB |
| Tags | CPython 3.6 CPython 3.6 pymalloc Linux musl 1.2+ x86-64 |
|
SHA-256 checksum How to use checksums |
847408adc4f2f3f1780cfdda551cc734bf782178880f7f97c3a13a1c2e9d85f3
|
|
BLAKE2b-256 checksum How to use checksums |
1cfe4ef9733bd71e391ecc80d22f21334a05f400ce29cb21584bb58297c61f68
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.12.8
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Apr 24, 2025.
Transparency logRelease files / pyopa-0.8.6-cp36-cp36m-manylinux_2_17_x86_64.manylinux2014_x86_64.whl
| Download URL | pyopa-0.8.6-cp36-cp36m-manylinux_2_17_x86_64.manylinux2014_x86_64.whl |
|---|---|
| Size | 4.0 MB |
| Tags | CPython 3.6 CPython 3.6 pymalloc Linux glibc 2.17+ x86-64 |
|
SHA-256 checksum How to use checksums |
0c211c7fb3dac6dcada7c6c2d406c13fb216a56273e4e2d021f7f86363833453
|
|
BLAKE2b-256 checksum How to use checksums |
a390c4c5c98f079f5747707fd077f0856add96a69b58b9ad7d7145948dfb90dd
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.12.8
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Apr 24, 2025.
Transparency logRelease files / pyopa-0.8.6-cp36-cp36m-macosx_10_9_x86_64.whl
| Download URL | pyopa-0.8.6-cp36-cp36m-macosx_10_9_x86_64.whl |
|---|---|
| Size | 3.5 MB |
| Tags | CPython 3.6 CPython 3.6 pymalloc macOS 10.9+ x86-64 |
|
SHA-256 checksum How to use checksums |
933f7fdc3361e29eec9c432d11da2b824e95cab8c9ec1650d021654d5bd06ca2
|
|
BLAKE2b-256 checksum How to use checksums |
efdc69b91cf6c06e223d69365f34da1a066d7d794f84e0c6cb9fd2822e30ca21
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
Yes |
| Uploaded via |
twine/6.1.0 CPython/3.12.8
|
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
PyPI Publish Attestation
PyPI verified that this artifact, at this checksum, originated from the publisher listed below.
Signed by GitHub Actions, verified by PyPI on Apr 24, 2025.
Transparency log
