Skip to main content

seqrepo-rest-api

Provides SeqRepo and GA4GH RefGet REST interfaces to biological sequences and sequence metadata from an existing seqrepo sequence repository.

Important changes

Breaking Change (July 2022): SEQREPO_DIR is now ignored. You must pass the seqrepo instance directory explicitly. See examples below.

Description

Specific, named biological sequences provide the reference and coordinate sysstem for communicating variation and consequential phenotypic changes. Several databases of sequences exist, with significant overlap, all using distinct names. Furthermore, these systems are often difficult to install locally.

Clients refer to sequences and metadata using familiar identifiers, such as NM_000551.3 or GRCh38:1, or any of several hash-based identifiers. The interface supports fast slicing of arbitrary regions of large sequences.

A "fully-qualified" identifier includes a namespace to disambiguate accessions (e.g., "1" in GRCh37 and GRCh38). If the namespace is provided, seqrepo uses it as-is. If the namespace is not provided and the unqualified identifier refers to a unique sequence, it is returned; otherwise, ambiguous identifiers will raise an error.

SeqRepo favors identifiers from identifiers.org whenever available. Examples include refseq and ensembl.

This repository is the REST interface only. The underlying data is provided by seqrepo.

This repository also implements the GA4GH refget (v1) protocol at <baseurl>/refget/.

Released under the Apache License, 2.0.

Links: Issues | Docker image

Citation

Hart RK, Prlić A (2020)
SeqRepo: A system for managing local collections of biological sequences.
PLoS ONE 15(12): e0239883. https://doi.org/10.1371/journal.pone.0239883

Examples

OpenAPI docs

The REST interface is implemented with OpenAPI. Current and interactive documentation is available at the base url for the endpoint.

OpenAPI UI Screenshot

Fetch Sequence

Fetch sequence by an accession:

$ curl -f http://0.0.0.0:5000/seqrepo/1/sequence/NP_001274413.1
MERSFVWLSCLDSDSCNLTFRLGEVESHACSPSLLWNLLTQYLPPGAGHILRTYNFPVLSCVSSCHLIGGKMPEN

Or not:

$ curl -f http://0.0.0.0:5000/seqrepo/1/sequence/bogus
curl: (22) The requested URL returned error: 404 NOT FOUND

Popular digests are also available:

$ curl -f http://0.0.0.0:5000/seqrepo/1/sequence/MD5:d52770ec477d0c9ee01fa034aff62cb4
MERSFVWLSCLDSDSCNLTFRLGEVESHACSPSLLWNLLTQYLPPGAGHILRTYNFPVLSCVSSCHLIGGKMPEN

With range:

# 👉 Seqrepo uses interbase coordinates.
$ curl -f "http://0.0.0.0:5000/seqrepo/1/sequence/NP_001274413.1?start=5&end=10"
VWLSC

Fetch Metadata

$ curl -f "http://0.0.0.0:5000/seqrepo/1/metadata/GRCh38:1"
{
  "added": "2016-08-27T21:17:00Z",
  "aliases": [
    "GRCh38:1",
    "GRCh38:chr1",
    "GRCh38.p1:1",
    "GRCh38.p1:chr1",
	⋮
    "GRCh38.p9:chr1",
    "MD5:6aef897c3d6ff0c78aff06ac189178dd",
    "refseq:NC_000001.11",
    "SEGUID:FCUd6VJ6uikS/VWLbhGdVmj2rOA",
    "SHA1:14251de9527aba2912fd558b6e119d5668f6ace0",
    "sha512t24u:Ya6Rs7DHhDeg7YaOSg1EoNi3U_nQ9SvO",
    "ga4gh:SQ.Ya6Rs7DHhDeg7YaOSg1EoNi3U_nQ9SvO"
  ],
  "alphabet": "ACGMNRT",
  "length": 248956422
}

Development

$ make devready
$ source venv/bin/activate

Running a local instance

Once installed as above, you should be able to:

$ seqrepo-rest-service /usr/local/share/seqrepo/2021-01-29

The navigate to the URL shown in the console output.

Building and running a docker image

A docker image can be built with this repo or pulled from docker hub. In either case, the container requires an existing local seqrepo sequence repository.

To build a docker image in this repo:

make docker-image

This will create biocommons/seqrepo-rest-service:lastest, like this:

$ docker images 
REPOSITORY                        TAG     IMAGE ID       CREATED          SIZE
biocommons/seqrepo-rest-service   latest  ad9ca051c5c9   2 minutes ago    627MB

This docker image is periodically pushed to docker hub.

Invoke the docker image like this this:

docker run \
  --name seqrepo-rest-service \
  --detach --rm -p 5000:5000 \
  -v /usr/local/share/seqrepo/2021-01-29:/mnt/seqrepo \
  biocommons/seqrepo-rest-service \
  seqrepo-rest-service /mnt/seqrepo

You should then be able to fetch a test sequence like this:

$ curl 'http://127.0.0.1:5000/seqrepo/1/sequence/refseq:NM_000551.3?end=20'
CCTCGCCTCCGTTACAACGG

If things aren't working, check the logs with docker logs -f seqrepo-rest-service.

Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

seqrepo-rest-service-0.2.2.tar.gz (266.4 kB view details)

Uploaded Source

Built Distribution

If you're not sure about the file name format, learn more about wheel file names.

seqrepo_rest_service-0.2.2-py3-none-any.whl (21.6 kB view details)

Uploaded Python 3

File details

Details for the file seqrepo-rest-service-0.2.2.tar.gz.

File metadata

  • Download URL: seqrepo-rest-service-0.2.2.tar.gz
  • Upload date:
  • Size: 266.4 kB
  • Tags: Source
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/4.0.2 CPython/3.11.6

File hashes

Hashes for seqrepo-rest-service-0.2.2.tar.gz
Algorithm Hash digest
SHA256 a6dd0ad3beea4445bae885dcfd188d70afa18dddd22830c262256be60738364a
MD5 9d484b18259256dcef43c6482cfa2aaa
BLAKE2b-256 0e464d01480f6b3cd4a166603901621d9bbc206a7ad4f5e3f56e5231d5557634

See more details on using hashes here.

File details

Details for the file seqrepo_rest_service-0.2.2-py3-none-any.whl.

File metadata

File hashes

Hashes for seqrepo_rest_service-0.2.2-py3-none-any.whl
Algorithm Hash digest
SHA256 5131e37f117f93ee05c174c28a15271853ff36fb5892402a6c2111430f17bae2
MD5 07279c8850a82617934f234f123a7135
BLAKE2b-256 f38de1eef15cad26930047cba583ccfea4e348f8580ffabae7e00db18b296c8e

See more details on using hashes here.

Supported by

AWS Cloud computing and Security Sponsor Datadog Monitoring Depot Continuous Integration Fastly CDN Google Download Analytics Sentry Error logging StatusPage Status page