THOIPApy
The Transmembrane HOmodimer Interface Prediction Algorithm (THOIPA) is a machine learning method for the analysis of protein-protein-interactions.
THOIPA predicts transmembrane homodimer interface residues from evolutionary sequence information.
THOIPA helps predict potential homotypic transmembrane interface residues, which can then be verified experimentally. THOIPA also aids in the energy-based modelling of transmembrane homodimers.
Important links:
How does thoipapy work?
downloads protein homologues with BLAST
extracts residue properties (e.g. residue conservation and polarity)
trains a machine learning classifier
validates the prediction performance
creates heatmaps of residue properties and THOIPA prediction
Installation
pip install thoipapy
THOIPA has only been tested on Linux, due to reliance on external dependencies such as FreeContact, Phobius, CD-HIT and rate4site. For predictions only, a dockerised version is available that runs on Windows or MacOS. Please see the THOIPA webserver for the latest information.
Dependencies
We recommend the Anaconda python distribution, which contains all the required python modules (numpy, scipy, pandas,biopython and matplotlib). THOIPApy is currently tested for python 3.8.5. The requirements.txt contains a snapshot of compatible dependencies.
Development status
The code has been extensively updated and annotated for public release. However is released “as is” with some known issues, limitations and legacy code.
Usage as a standalone predictor
first check if your needs are met by the THOIPA webserver or the latest version of dockerised software
for local predictions on linux, first install phobius, NCBI_BLAST, biopython, freecontact, CD-HIT, and rate4site
please see thoipapy/test/functional/test_standalone_prediction.py for the latest run syntax, typically
from thoipapy.thoipa import get_md5_checksum, run_THOIPA_prediction
from thoipapy.utils import make_sure_path_exists
protein_name = "ERBB3"
TMD_seq = "MALTVIAGLVVIFMMLGGTFL"
full_seq = "MVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLTMALTVIAGLVVIFMMLGGTFLYWRGRRIQNKRAMRRYLERGESIEPLDPSEKANKVLA"
out_dir = "/path/to/your/desired/output/folder"
make_sure_path_exists(out_dir)
md5 = get_md5_checksum(TMD_seq, full_seq)
run_THOIPA_prediction(protein_name, md5, TMD_seq, full_seq, out_dir)
Example Output
the output includes a csv showing the THOIPA prediction for each residue, as well as a heatmap figure as a summary
below is a heatmap showing the THOIPA prediction, and underlying conservation, relative polarity, and coevolution
Create your own machine learning predictor
THOIPA can be retrained to any dataset of your choice
the original set of training sequences and other resources are available via the Open Science Foundation
the THOIPA feature extraction, feature selection, and training pipeline is fully automated
contact us for an introduction to the THOIPA software pipeline and settings
python path/to/thoipapy/run.py -s home/user/thoipa/THOIPA_settings.xlsx
License
THOIPApy is free software distributed under the permissive MIT License.
Contribute
Contributors are welcome.
For feedback or troubleshooting, please email us directly and initiate an issue in Github.
Contact
Mark Teese, TNG Technology Consulting GmbH, formerly of the Langosch Lab at the Technical University of Munich
Bo Zeng, Chinese Academy of Sciences, Beijing formerly of the Frishman Lab at the Technical University of Munich
Citation
Download files
Download the file for your platform. If you're not sure which to choose, learn more about installing packages.
Source Distribution
Built Distribution
Filter files by name, interpreter, ABI, and platform.
If you're not sure about the file name format, learn more about wheel file names.
Copy a direct link to the current filters
File details
Details for the file thoipapy-1.2.0.tar.gz.
File metadata
- Download URL: thoipapy-1.2.0.tar.gz
- Upload date:
- Size: 156.6 kB
- Tags: Source
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/3.2.0 pkginfo/1.5.0.1 requests/2.24.0 setuptools/49.6.0.post20200814 requests-toolbelt/0.9.1 tqdm/4.49.0 CPython/3.8.5
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
66225fbff340faf0cfb30d546f75ba1f12c52d8aba19da6afc99355e2899e8bd
|
|
| MD5 |
ff8c0f1096ee621b9f27b6a5f1c94535
|
|
| BLAKE2b-256 |
38c8a4d382dd3dbbaaa2eab379566063406ce5fd4bcd3027b75e89a5601841dc
|
File details
Details for the file thoipapy-1.2.0-py3-none-any.whl.
File metadata
- Download URL: thoipapy-1.2.0-py3-none-any.whl
- Upload date:
- Size: 329.4 kB
- Tags: Python 3
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/3.2.0 pkginfo/1.5.0.1 requests/2.24.0 setuptools/49.6.0.post20200814 requests-toolbelt/0.9.1 tqdm/4.49.0 CPython/3.8.5
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
52403c9767e53bd34dedd9a82d3988aac89590aa255da171d58d708f5cadcd42
|
|
| MD5 |
811fd544ac37ed9d2d5993ee7f7c6c24
|
|
| BLAKE2b-256 |
5a1666431b1409242506772452e8e0ef0ad1e341c982ca8162a92bb041805456
|