TM-Tools
Python bindings for the TM-align algorithm and code developed by Zhang et al for protein structure comparison.
Installation
You can install the released version of the package directly from PyPI by running
pip install tmtools
Pre-built wheels are available for Linux, macOS, and Windows, for Python 3.10 and up (currently 3.10-3.14).
Usage
The function tmtools.tm_align takes two NumPy arrays with coordinates for the
residues (with shape (N, 3)) and two sequences of peptide codes, performs the
alignment, and returns the optimal rotation matrix and translation, along with
the TM score:
>>> import numpy as np
>>> from tmtools import tm_align
>>>
>>> coords1 = np.array(
... [[1.2, 3.4, 1.5],
... [4.0, 2.8, 3.7],
... [1.2, 4.2, 4.3],
... [0.0, 1.0, 2.0]])
>>> coords2 = np.array(
... [[2.3, 7.4, 1.5],
... [4.0, 2.9, -1.7],
... [1.2, 4.2, 4.3]])
>>>
>>> seq1 = "AYLP"
>>> seq2 = "ARN"
>>>
>>> res = tm_align(coords1, coords2, seq1, seq2)
>>> res.t
array([ 2.94676159, 5.55265245, -1.75151383])
>>> res.u
array([[ 0.40393231, 0.04161396, -0.91384187],
[-0.59535733, 0.77040999, -0.22807475],
[ 0.69454181, 0.63618922, 0.33596866]])
>>> res.tm_norm_chain1
0.3105833326322145
>>> res.tm_norm_chain2
0.414111110176286
>>> res.rmsd
0.39002811082975875
You can also provide a user-defined alignment instead of letting TM-align compute the optimal alignment automatically. This is useful when you have domain knowledge about the correct alignment or want to test specific alignment hypotheses:
>>> # Define a custom alignment with gaps marked as '-'
>>> alignment = ["A-YLP", "AR-N-"]
>>> res = tm_align(coords1, coords2, seq1, seq2, alignment=alignment)
>>> res.tm_norm_chain1
0.3105833326322145
>>> res.tm_norm_chain2
0.414111110176286
Note that the ungapped sequences in the alignment must exactly match the input
sequences seq1 and seq2.
If you already have some PDB files, you can use the functions from tmalign.io
to retrieve the coordinate and sequence data. These functions rely on
BioPython, which is not installed by default to keep dependencies
lightweight. To use them, you have to install BioPython first (pip install biopython). Then run:
>>> from tmtools.io import get_structure, get_residue_data
>>> from tmtools.testing import get_pdb_path
>>> s = get_structure(get_pdb_path("2gtl"))
>>> s
<Structure id=2gtl>
>>> chain = next(s.get_chains())
>>> coords, seq = get_residue_data(chain)
>>> seq
'DCCSYEDRREIRHIWDDVWSSSFTDRRVAIVRAVFDDLFKHYPTSKALFERVKIDEPESGEFKSHLVRVANGLKLLINLLDDTLVLQSHLGHLADQHIQRKGVTKEYFRGIGEAFARVLPQVLSCFNVDAWNRCFHRLVARIAKDLP'
>>> coords.shape
(147, 3)
For debugging purposes, you can use the function tmtools.print_version, which prints the version of the underlying TM-align library directly to the standard output.
>>> from tmtools import print_version
>>> print_version()
*********************************************************************
* TM-align (Version 20210224): protein structure alignment *
* References: Y Zhang, J Skolnick. Nucl Acids Res 33, 2302-9 (2005) *
* Please email comments and suggestions to yangzhanglab@umich.edu *
*********************************************************************
Development mode
To build the package from scratch, e.g. because you want to contribute to it, clone this repository, and then from the root of the repository, run
pip install -e . -v
This requires a C++ compiler to be installed with support for C++ 14.
This project uses ruff as a code formatter and linter. Ruff is run automatically via GitHub actions on new commits, please consider running locally (preferably via a pre-commit hook) to notice and fix any errors early on.
Running the tests
The test suite uses the standard Python unittest framework. To run the test suite, run the following command (from the root of the repository, with the development environment activated):
python -m unittest discover -v .
When adding to the test suite, please adhere to the given/when/then pattern. You can refer to the existing tests for an example.
Credits
This package arose out of a personal desire to better understand both the TM-score algorithm and the pybind11 library to interface with C++ code. At this point in time it contains no original research code.
If you use the package for research, you should cite the original TM-score papers:
- Y. Zhang, J. Skolnick, Scoring function for automated assessment of protein structure template quality, Proteins, 57: 702-710 (2004).
- J. Xu, Y. Zhang, How significant is a protein structure similarity with TM-score=0.5? Bioinformatics, 26, 889-895 (2010).
License
The original TM-align software (version 20210224, released under the MIT
license) is bundled with this repository (src/extern/TMalign.cpp). Some small
tweaks had to be made to compile the code on macOS and to embed it as a
library. This modifications are also released under the MIT license.
The rest of the codebase is released under the GPL v3 license.
Release files for tmtools 0.3.0
For a detailed explanation of source distributions (sdists) and built distributions (wheels), please see the package formats documentation.
Source distribution (sdist)
| File | Size | Uploaded | |
|---|---|---|---|
| tmtools-0.3.0.tar.gz | 3.1 MB | Details |
Built distributions (wheels)
Total release size: 85.2 MB
Release files / tmtools-0.3.0.tar.gz
| Download URL | tmtools-0.3.0.tar.gz |
|---|---|
| Size | 3.1 MB |
| Tags | Source |
|
SHA-256 checksum How to use checksums |
06010d6c2b6272f19b86e6260ce9f3175f3b601fba46520d57a5fa3ce1d4761d
|
|
BLAKE2b-256 checksum How to use checksums |
4d31677c0e06a628f915832d6fdc805728e5f8a62ed8cf6053b6e480b39ab484
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
No |
| Uploaded via |
twine/6.2.0 CPython/3.9.25
|
Release files / tmtools-0.3.0-cp312-cp312-win_amd64.whl
| Download URL | tmtools-0.3.0-cp312-cp312-win_amd64.whl |
|---|---|
| Size | 3.2 MB |
| Tags | CPython 3.12 Windows x86-64 |
|
SHA-256 checksum How to use checksums |
1f8ffaa020cfe2a705e100a3d2f52350281c5ae15b6a71f40993b275e2a40430
|
|
BLAKE2b-256 checksum How to use checksums |
0c926aecfce9fd3e8d9b43e40647f8968610d11bac53427046d44626e1df8a4a
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
No |
| Uploaded via |
twine/6.2.0 CPython/3.9.25
|
Release files / tmtools-0.3.0-cp312-cp312-win32.whl
| Download URL | tmtools-0.3.0-cp312-cp312-win32.whl |
|---|---|
| Size | 3.2 MB |
| Tags | CPython 3.12 Windows x86-32 |
|
SHA-256 checksum How to use checksums |
4a9a3c69782fffe87c00bb99e0b8bc994dc58a67d38f0b1c30e87d73895b528b
|
|
BLAKE2b-256 checksum How to use checksums |
8ef1dd2950ad1860ac412de5b159f46187a9cab620710175abc7579efb7a959b
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
No |
| Uploaded via |
twine/6.2.0 CPython/3.9.25
|
Release files / tmtools-0.3.0-cp312-cp312-musllinux_1_1_x86_64.whl
| Download URL | tmtools-0.3.0-cp312-cp312-musllinux_1_1_x86_64.whl |
|---|---|
| Size | 3.8 MB |
| Tags | CPython 3.12 Linux musl 1.1+ x86-64 |
|
SHA-256 checksum How to use checksums |
cde19ef37a6878fbf2cb7682352b3aa97c4cd6ccb8403517d2f90753c120ee0a
|
|
BLAKE2b-256 checksum How to use checksums |
2ce16110d9f4ce517478040fd33033b8be1f5c1cf45e09ace45ea8c8865a8c90
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
No |
| Uploaded via |
twine/6.2.0 CPython/3.9.25
|
Release files / tmtools-0.3.0-cp312-cp312-musllinux_1_1_i686.whl
| Download URL | tmtools-0.3.0-cp312-cp312-musllinux_1_1_i686.whl |
|---|---|
| Size | 3.9 MB |
| Tags | CPython 3.12 Linux musl 1.1+ x86-32 |
|
SHA-256 checksum How to use checksums |
567542c451872c7893b652b8f3935aceff7da78188970542ad1ad5395e84564b
|
|
BLAKE2b-256 checksum How to use checksums |
0e212743c39bf26906b8231469da9b32091be5965efc1e84831a33a22e7a3d69
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
No |
| Uploaded via |
twine/6.2.0 CPython/3.9.25
|
Release files / tmtools-0.3.0-cp312-cp312-manylinux_2_17_x86_64.manylinux2014_x86_64.whl
| Download URL | tmtools-0.3.0-cp312-cp312-manylinux_2_17_x86_64.manylinux2014_x86_64.whl |
|---|---|
| Size | 3.3 MB |
| Tags | CPython 3.12 Linux glibc 2.17+ x86-64 |
|
SHA-256 checksum How to use checksums |
74bdea863afa4c6c29b95635fa63c6b3f8eac32c996b95e22be1708c5e4e1205
|
|
BLAKE2b-256 checksum How to use checksums |
aaf90d4ec2085746545b3d966c04fafb98a707622f964af0709eaddce72569c6
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
No |
| Uploaded via |
twine/6.2.0 CPython/3.9.25
|
Release files / tmtools-0.3.0-cp312-cp312-manylinux_2_17_i686.manylinux2014_i686.whl
| Download URL | tmtools-0.3.0-cp312-cp312-manylinux_2_17_i686.manylinux2014_i686.whl |
|---|---|
| Size | 3.3 MB |
| Tags | CPython 3.12 Linux glibc 2.17+ x86-32 |
|
SHA-256 checksum How to use checksums |
52c1fe29ab8230a08a95866be239e33005e9ee2156c3caa152c552d0e3ec04cd
|
|
BLAKE2b-256 checksum How to use checksums |
5da65999830398295403869a0570ace3c4e30737e943b5fee7d0b0cca7d3d020
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
No |
| Uploaded via |
twine/6.2.0 CPython/3.9.25
|
Release files / tmtools-0.3.0-cp312-cp312-macosx_11_0_arm64.whl
| Download URL | tmtools-0.3.0-cp312-cp312-macosx_11_0_arm64.whl |
|---|---|
| Size | 3.3 MB |
| Tags | CPython 3.12 macOS 11.0+ ARM64 |
|
SHA-256 checksum How to use checksums |
16f79aee1370f28fd6c4ef843f0d2b2c5e9db81ae602facb1fe384d889dfd620
|
|
BLAKE2b-256 checksum How to use checksums |
cf37fd9f6414933cfdfe4442f5694e9f73cf5b8f24d1c47c3e960b258d6a2555
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
No |
| Uploaded via |
twine/6.2.0 CPython/3.9.25
|
Release files / tmtools-0.3.0-cp312-cp312-macosx_10_9_x86_64.whl
| Download URL | tmtools-0.3.0-cp312-cp312-macosx_10_9_x86_64.whl |
|---|---|
| Size | 3.3 MB |
| Tags | CPython 3.12 macOS 10.9+ x86-64 |
|
SHA-256 checksum How to use checksums |
b98b66131a3493a6cfe534748730b01b6b92851122acb725a7c74b82dcb55768
|
|
BLAKE2b-256 checksum How to use checksums |
af1e121fa9bcfb588396c5d1f02986ac411995ad07e1924b329c7c8f09d7737a
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
No |
| Uploaded via |
twine/6.2.0 CPython/3.9.25
|
Release files / tmtools-0.3.0-cp311-cp311-win_amd64.whl
| Download URL | tmtools-0.3.0-cp311-cp311-win_amd64.whl |
|---|---|
| Size | 3.2 MB |
| Tags | CPython 3.11 Windows x86-64 |
|
SHA-256 checksum How to use checksums |
45d3c8535cbe4e4f3c86057729fc1a7d431d3cf5613e0636c405d07b55a53f1f
|
|
BLAKE2b-256 checksum How to use checksums |
f147f8b7a6f57928cc01c33615d03ac06eb327d89699f7c46537cb485a65162d
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
No |
| Uploaded via |
twine/6.2.0 CPython/3.9.25
|
Release files / tmtools-0.3.0-cp311-cp311-win32.whl
| Download URL | tmtools-0.3.0-cp311-cp311-win32.whl |
|---|---|
| Size | 3.2 MB |
| Tags | CPython 3.11 Windows x86-32 |
|
SHA-256 checksum How to use checksums |
966c492f8f820cd249056ab0927cd51d6c8a6f0a1b4ae426a52731ec14635bbc
|
|
BLAKE2b-256 checksum How to use checksums |
4b993b3233a11fe2bbc04d0bfa1eaaacb8a5a52f0d527b270e16a82064603476
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
No |
| Uploaded via |
twine/6.2.0 CPython/3.9.25
|
Release files / tmtools-0.3.0-cp311-cp311-musllinux_1_1_x86_64.whl
| Download URL | tmtools-0.3.0-cp311-cp311-musllinux_1_1_x86_64.whl |
|---|---|
| Size | 3.8 MB |
| Tags | CPython 3.11 Linux musl 1.1+ x86-64 |
|
SHA-256 checksum How to use checksums |
4a13d4227f015dd74cea2d976c7461e0747f2d7e6384cad2fc6aa8d0fb5cc7d0
|
|
BLAKE2b-256 checksum How to use checksums |
0300bad4a399e448bf741fcbabb0dfac78518b43b621d1c26af22050353fb1bc
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
No |
| Uploaded via |
twine/6.2.0 CPython/3.9.25
|
Release files / tmtools-0.3.0-cp311-cp311-musllinux_1_1_i686.whl
| Download URL | tmtools-0.3.0-cp311-cp311-musllinux_1_1_i686.whl |
|---|---|
| Size | 3.9 MB |
| Tags | CPython 3.11 Linux musl 1.1+ x86-32 |
|
SHA-256 checksum How to use checksums |
88e025a7be7aaa1b1982714a2bda4115cb28a67a274c733003f7a82cc2e373da
|
|
BLAKE2b-256 checksum How to use checksums |
1e7f46da1d561f78340005f9a2ba8426157a8dfdd6cf426882af8d7e4a0f1bbf
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
No |
| Uploaded via |
twine/6.2.0 CPython/3.9.25
|
Release files / tmtools-0.3.0-cp311-cp311-manylinux_2_17_x86_64.manylinux2014_x86_64.whl
| Download URL | tmtools-0.3.0-cp311-cp311-manylinux_2_17_x86_64.manylinux2014_x86_64.whl |
|---|---|
| Size | 3.3 MB |
| Tags | CPython 3.11 Linux glibc 2.17+ x86-64 |
|
SHA-256 checksum How to use checksums |
1f07834954c3a47fb90ab28ae4385292519bdbbb6ff8f10b4022dce84a00b844
|
|
BLAKE2b-256 checksum How to use checksums |
1d7263ee5cc11a18c4eb3e2bc413041eeea1663f49f568502b8bdc116e98305d
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
No |
| Uploaded via |
twine/6.2.0 CPython/3.9.25
|
Release files / tmtools-0.3.0-cp311-cp311-manylinux_2_17_i686.manylinux2014_i686.whl
| Download URL | tmtools-0.3.0-cp311-cp311-manylinux_2_17_i686.manylinux2014_i686.whl |
|---|---|
| Size | 3.3 MB |
| Tags | CPython 3.11 Linux glibc 2.17+ x86-32 |
|
SHA-256 checksum How to use checksums |
5c7cf5f83bdab941201af9c79e310bee0534794569189a952f7ff0876dcc1a31
|
|
BLAKE2b-256 checksum How to use checksums |
733cbb09bde745dd940ce8fb96bf80f9990fdb4b5cabb9c9dcac3f770fb8dfd7
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
No |
| Uploaded via |
twine/6.2.0 CPython/3.9.25
|
Release files / tmtools-0.3.0-cp311-cp311-macosx_11_0_arm64.whl
| Download URL | tmtools-0.3.0-cp311-cp311-macosx_11_0_arm64.whl |
|---|---|
| Size | 3.3 MB |
| Tags | CPython 3.11 macOS 11.0+ ARM64 |
|
SHA-256 checksum How to use checksums |
0639344b263a054fbe7cd18fea56bdae0e6ae310498ffa6ba569eb025b5e5da6
|
|
BLAKE2b-256 checksum How to use checksums |
90591215d9c656992a8ba2c7793e29c48f50490f847af4fcaf4ae77384b3c048
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
No |
| Uploaded via |
twine/6.2.0 CPython/3.9.25
|
Release files / tmtools-0.3.0-cp311-cp311-macosx_10_9_x86_64.whl
| Download URL | tmtools-0.3.0-cp311-cp311-macosx_10_9_x86_64.whl |
|---|---|
| Size | 3.3 MB |
| Tags | CPython 3.11 macOS 10.9+ x86-64 |
|
SHA-256 checksum How to use checksums |
e0f4f5eda0a2c6e7dadd6720f1e956b70dd59cb677a1b18d62ba6d60bcbd6e5f
|
|
BLAKE2b-256 checksum How to use checksums |
6d9e2db263d5d860b1127aabf8270afe4c2fff389ca4c23b0e0a848576c429ac
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
No |
| Uploaded via |
twine/6.2.0 CPython/3.9.25
|
Release files / tmtools-0.3.0-cp310-cp310-win_amd64.whl
| Download URL | tmtools-0.3.0-cp310-cp310-win_amd64.whl |
|---|---|
| Size | 3.2 MB |
| Tags | CPython 3.10 Windows x86-64 |
|
SHA-256 checksum How to use checksums |
992c001235ffed0877837c346f312bd9b198edae1bae3db6a993b637ad0c1ec2
|
|
BLAKE2b-256 checksum How to use checksums |
bd79335f7cbab27b10c288823704eccb0749ac9ec5f1c15741b4137a9644e46d
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
No |
| Uploaded via |
twine/6.2.0 CPython/3.9.25
|
Release files / tmtools-0.3.0-cp310-cp310-win32.whl
| Download URL | tmtools-0.3.0-cp310-cp310-win32.whl |
|---|---|
| Size | 3.2 MB |
| Tags | CPython 3.10 Windows x86-32 |
|
SHA-256 checksum How to use checksums |
c8cfcf395b1b34bdf33b49b1883ccc3eafca7aa12e257fe5529a7d1d7579e458
|
|
BLAKE2b-256 checksum How to use checksums |
b255eb0ca9d20b521f0047d8f5e64b6640f8ab2a2b334173249821dd5c1154e8
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
No |
| Uploaded via |
twine/6.2.0 CPython/3.9.25
|
Release files / tmtools-0.3.0-cp310-cp310-musllinux_1_1_x86_64.whl
| Download URL | tmtools-0.3.0-cp310-cp310-musllinux_1_1_x86_64.whl |
|---|---|
| Size | 3.8 MB |
| Tags | CPython 3.10 Linux musl 1.1+ x86-64 |
|
SHA-256 checksum How to use checksums |
99e1d7c2ebbd029e22496dc75cfc2bc48431ee6669275e5cdb8de60565d9ffa1
|
|
BLAKE2b-256 checksum How to use checksums |
91fcd2efeca926dcc45ba388f494b492182b2360b338557ef2ebe576d07d7c59
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
No |
| Uploaded via |
twine/6.2.0 CPython/3.9.25
|
Release files / tmtools-0.3.0-cp310-cp310-musllinux_1_1_i686.whl
| Download URL | tmtools-0.3.0-cp310-cp310-musllinux_1_1_i686.whl |
|---|---|
| Size | 3.9 MB |
| Tags | CPython 3.10 Linux musl 1.1+ x86-32 |
|
SHA-256 checksum How to use checksums |
726e94ab927aa9d739bc0ba69da4291c363c521b28befe572941c3062c9f7e57
|
|
BLAKE2b-256 checksum How to use checksums |
3d1c8a357b3e48747a06f30f0513c6e635c1a5ac3bcbc5cca9eb39abe2517e5b
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
No |
| Uploaded via |
twine/6.2.0 CPython/3.9.25
|
Release files / tmtools-0.3.0-cp310-cp310-manylinux_2_17_x86_64.manylinux2014_x86_64.whl
| Download URL | tmtools-0.3.0-cp310-cp310-manylinux_2_17_x86_64.manylinux2014_x86_64.whl |
|---|---|
| Size | 3.3 MB |
| Tags | CPython 3.10 Linux glibc 2.17+ x86-64 |
|
SHA-256 checksum How to use checksums |
6bc3d4943b1755dab8d9867c8734ef62edd822afdea22ba21379a920f159f962
|
|
BLAKE2b-256 checksum How to use checksums |
121d457688a790843a4820c75a32629f7d19a823e3f695e7d176ffd89590da90
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
No |
| Uploaded via |
twine/6.2.0 CPython/3.9.25
|
Release files / tmtools-0.3.0-cp310-cp310-manylinux_2_17_i686.manylinux2014_i686.whl
| Download URL | tmtools-0.3.0-cp310-cp310-manylinux_2_17_i686.manylinux2014_i686.whl |
|---|---|
| Size | 3.3 MB |
| Tags | CPython 3.10 Linux glibc 2.17+ x86-32 |
|
SHA-256 checksum How to use checksums |
3cd2f27cd41f0d79785638b60f82eca595b23dc717a883b5005992fe259e6876
|
|
BLAKE2b-256 checksum How to use checksums |
67baf484cbdfba5c401e3be240427600ec6595be0aba4d7723500ebab10dc07a
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
No |
| Uploaded via |
twine/6.2.0 CPython/3.9.25
|
Release files / tmtools-0.3.0-cp310-cp310-macosx_11_0_arm64.whl
| Download URL | tmtools-0.3.0-cp310-cp310-macosx_11_0_arm64.whl |
|---|---|
| Size | 3.3 MB |
| Tags | CPython 3.10 macOS 11.0+ ARM64 |
|
SHA-256 checksum How to use checksums |
578d99e1951f08c7842941a6b15a8182886a2fef9e279a4bb6b28174c7d1b23a
|
|
BLAKE2b-256 checksum How to use checksums |
3df2747cebce57ddd4607ac089d0ff388e8dc9e229ef7d87286f4c816bb55123
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
No |
| Uploaded via |
twine/6.2.0 CPython/3.9.25
|
Release files / tmtools-0.3.0-cp310-cp310-macosx_10_9_x86_64.whl
| Download URL | tmtools-0.3.0-cp310-cp310-macosx_10_9_x86_64.whl |
|---|---|
| Size | 3.3 MB |
| Tags | CPython 3.10 macOS 10.9+ x86-64 |
|
SHA-256 checksum How to use checksums |
cb19d7f46cdd02501ad7a630ca3059fcf311324c96842fb790270fce3e5705b6
|
|
BLAKE2b-256 checksum How to use checksums |
dea5f9f399b258866785bf8f4c509c5a45ed492ab4d19f1375434de9f674e2a6
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
No |
| Uploaded via |
twine/6.2.0 CPython/3.9.25
|