Skip to main content

Python bindings around the TM-align code for structural alignment of proteins

Project description

TM-Tools

Python bindings for the TM-align algorithm and code developed by Zhang et al for protein structure comparison.

Installation

From the console, simply run

    pip install git+https://github.com/jvkersch/tmtools.git#egg=tmtools

The package supports Python 3.6 and up. You will need a fairly recent version of pip, as well as a C++ compiler that supports C++ 14.

This package supports Linux, macOS, and Windows.

Usage

The function tmtools.tm_align takes two NumPy arrays with coordinates for the residues (with shape (N, 3)) and two sequences of peptide codes, performs the alignment, and returns the optimal rotation matrix and translation, along with the TM score:

>>> import numpy as np
>>> from tmtools import tm_align
>>>
>>> coords1 = np.array(
...     [[1.2, 3.4, 1.5],
...      [4.0, 2.8, 3.7],
...      [1.2, 4.2, 4.3],
...      [0.0, 1.0, 2.0]])
>>> coords2 = np.array(
...     [[2.3, 7.4, 1.5],
...      [4.0, 2.9, -1.7],
...      [1.2, 4.2, 4.3]])
>>>
>>> seq1 = "AYLP"
>>> seq2 = "ARN"
>>>
>>> res = tm_align(coords1, coords2, seq1, seq2)
>>> res.t
array([ 2.94676159,  5.55265245, -1.75151383])
>>> res.u
array([[ 0.40393231,  0.04161396, -0.91384187],
       [-0.59535733,  0.77040999, -0.22807475],
       [ 0.69454181,  0.63618922,  0.33596866]])
>>> res.tm_norm_chain1
0.3105833326322145
>>> res.tm_norm_chain2
0.414111110176286

If you already have some PDB files, you can use the functions from tmalign.io to retrieve the coordinate and sequence data:

>>> from tmtools.io import get_structure, get_residue_data
>>> from tmtools.testing import get_pdb_path
>>> s = get_structure(get_pdb_path("2gtl"))
>>> s
<Structure id=2gtl>
>>> chain = next(s.get_chains())
>>> coords, seq = get_residue_data(chain)
>>> seq
'DCCSYEDRREIRHIWDDVWSSSFTDRRVAIVRAVFDDLFKHYPTSKALFERVKIDEPESGEFKSHLVRVANGLKLLINLLDDTLVLQSHLGHLADQHIQRKGVTKEYFRGIGEAFARVLPQVLSCFNVDAWNRCFHRLVARIAKDLP'
>>> coords.shape
(147, 3)

These functions are light-weight wrappers around BioPython.

Credits

This package arose out of a personal desire to better understand both the TM-score algorithm and the pybind11 library to interface with C++ code. At this point in time it contains no original research code.

If you use the package for research, you should cite the original TM-score papers:

  • Y. Zhang, J. Skolnick, Scoring function for automated assessment of protein structure template quality, Proteins, 57: 702-710 (2004).
  • J. Xu, Y. Zhang, How significant is a protein structure similarity with TM-score=0.5? Bioinformatics, 26, 889-895 (2010).

License

The original TM-align software (version 20210224, released under the MIT license) is bundled with this repository (src/extern/TMalign.cpp). Some small tweaks had to be made to compile the code on macOS and to embed it as a library. This modifications are also released under the MIT license.

The rest of the codebase is released under the GPL v3 license.

Project details


Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distributions

No source distribution files available for this release.See tutorial on generating distribution archives.

Built Distributions

If you're not sure about the file name format, learn more about wheel file names.

tmtools-0.0.2-cp310-cp310-win_amd64.whl (1.5 MB view details)

Uploaded CPython 3.10Windows x86-64

tmtools-0.0.2-cp310-cp310-win32.whl (1.5 MB view details)

Uploaded CPython 3.10Windows x86

tmtools-0.0.2-cp310-cp310-manylinux_2_12_x86_64.manylinux2010_x86_64.whl (1.6 MB view details)

Uploaded CPython 3.10manylinux: glibc 2.12+ x86-64

tmtools-0.0.2-cp310-cp310-manylinux_2_12_i686.manylinux2010_i686.whl (1.6 MB view details)

Uploaded CPython 3.10manylinux: glibc 2.12+ i686

tmtools-0.0.2-cp39-cp39-win_amd64.whl (1.5 MB view details)

Uploaded CPython 3.9Windows x86-64

tmtools-0.0.2-cp39-cp39-win32.whl (1.5 MB view details)

Uploaded CPython 3.9Windows x86

tmtools-0.0.2-cp39-cp39-manylinux_2_12_x86_64.manylinux2010_x86_64.whl (1.6 MB view details)

Uploaded CPython 3.9manylinux: glibc 2.12+ x86-64

tmtools-0.0.2-cp39-cp39-manylinux_2_12_i686.manylinux2010_i686.whl (1.6 MB view details)

Uploaded CPython 3.9manylinux: glibc 2.12+ i686

tmtools-0.0.2-cp39-cp39-macosx_11_0_arm64.whl (1.6 MB view details)

Uploaded CPython 3.9macOS 11.0+ ARM64

tmtools-0.0.2-cp39-cp39-macosx_10_9_x86_64.whl (1.6 MB view details)

Uploaded CPython 3.9macOS 10.9+ x86-64

tmtools-0.0.2-cp38-cp38-win_amd64.whl (1.5 MB view details)

Uploaded CPython 3.8Windows x86-64

tmtools-0.0.2-cp38-cp38-win32.whl (1.5 MB view details)

Uploaded CPython 3.8Windows x86

tmtools-0.0.2-cp38-cp38-manylinux_2_12_x86_64.manylinux2010_x86_64.whl (1.6 MB view details)

Uploaded CPython 3.8manylinux: glibc 2.12+ x86-64

tmtools-0.0.2-cp38-cp38-manylinux_2_12_i686.manylinux2010_i686.whl (1.6 MB view details)

Uploaded CPython 3.8manylinux: glibc 2.12+ i686

tmtools-0.0.2-cp38-cp38-macosx_11_0_arm64.whl (1.6 MB view details)

Uploaded CPython 3.8macOS 11.0+ ARM64

tmtools-0.0.2-cp38-cp38-macosx_10_9_x86_64.whl (1.6 MB view details)

Uploaded CPython 3.8macOS 10.9+ x86-64

tmtools-0.0.2-cp37-cp37m-win_amd64.whl (1.5 MB view details)

Uploaded CPython 3.7mWindows x86-64

tmtools-0.0.2-cp37-cp37m-win32.whl (1.5 MB view details)

Uploaded CPython 3.7mWindows x86

tmtools-0.0.2-cp37-cp37m-manylinux_2_12_x86_64.manylinux2010_x86_64.whl (1.6 MB view details)

Uploaded CPython 3.7mmanylinux: glibc 2.12+ x86-64

tmtools-0.0.2-cp37-cp37m-manylinux_2_12_i686.manylinux2010_i686.whl (1.6 MB view details)

Uploaded CPython 3.7mmanylinux: glibc 2.12+ i686

tmtools-0.0.2-cp37-cp37m-macosx_10_9_x86_64.whl (1.6 MB view details)

Uploaded CPython 3.7mmacOS 10.9+ x86-64

tmtools-0.0.2-cp36-cp36m-win_amd64.whl (1.5 MB view details)

Uploaded CPython 3.6mWindows x86-64

tmtools-0.0.2-cp36-cp36m-win32.whl (1.5 MB view details)

Uploaded CPython 3.6mWindows x86

tmtools-0.0.2-cp36-cp36m-manylinux_2_12_x86_64.manylinux2010_x86_64.whl (1.6 MB view details)

Uploaded CPython 3.6mmanylinux: glibc 2.12+ x86-64

tmtools-0.0.2-cp36-cp36m-manylinux_2_12_i686.manylinux2010_i686.whl (1.6 MB view details)

Uploaded CPython 3.6mmanylinux: glibc 2.12+ i686

tmtools-0.0.2-cp36-cp36m-macosx_10_9_x86_64.whl (1.6 MB view details)

Uploaded CPython 3.6mmacOS 10.9+ x86-64

File details

Details for the file tmtools-0.0.2-cp310-cp310-win_amd64.whl.

File metadata

  • Download URL: tmtools-0.0.2-cp310-cp310-win_amd64.whl
  • Upload date:
  • Size: 1.5 MB
  • Tags: CPython 3.10, Windows x86-64
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.2-cp310-cp310-win_amd64.whl
Algorithm Hash digest
SHA256 b61150e03d472feb4f6ed6c30532d454db48468edb09b86787b56180043ec11b
MD5 bbbb4e8ce63a00f61a37235e62b414b5
BLAKE2b-256 8b27c40cb2e963ac5e611a89014e20018d6e1b2b754275015112eabbba4d4026

See more details on using hashes here.

File details

Details for the file tmtools-0.0.2-cp310-cp310-win32.whl.

File metadata

  • Download URL: tmtools-0.0.2-cp310-cp310-win32.whl
  • Upload date:
  • Size: 1.5 MB
  • Tags: CPython 3.10, Windows x86
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.2-cp310-cp310-win32.whl
Algorithm Hash digest
SHA256 bd2160a60e93ab1de8c40ca0608cf92b02624bbdceeb29e87b631a46dad31fd9
MD5 178a9a5ab9853d784738ae7efcaace09
BLAKE2b-256 8c9b7cd734beeba95075744e566d7f2ef0ccbb15cf8325fba9a84afb38a423b9

See more details on using hashes here.

File details

Details for the file tmtools-0.0.2-cp310-cp310-manylinux_2_12_x86_64.manylinux2010_x86_64.whl.

File metadata

File hashes

Hashes for tmtools-0.0.2-cp310-cp310-manylinux_2_12_x86_64.manylinux2010_x86_64.whl
Algorithm Hash digest
SHA256 713d975b67d37cd5deff1c4d9f0bbd5a1884ca7b0d60f98e1b74e8252071af3a
MD5 ab2573c44e18eb69038c238f6ab7ab7f
BLAKE2b-256 6c415e6458bfde1318723d9106d17e6dda7c135b59ea7ff8cf7fa4a5c4a598e1

See more details on using hashes here.

File details

Details for the file tmtools-0.0.2-cp310-cp310-manylinux_2_12_i686.manylinux2010_i686.whl.

File metadata

  • Download URL: tmtools-0.0.2-cp310-cp310-manylinux_2_12_i686.manylinux2010_i686.whl
  • Upload date:
  • Size: 1.6 MB
  • Tags: CPython 3.10, manylinux: glibc 2.12+ i686
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.2-cp310-cp310-manylinux_2_12_i686.manylinux2010_i686.whl
Algorithm Hash digest
SHA256 81fdbeb86a856dd5c644a1db261b30e2a413b08c52d593393d1ddf38ca7b1d18
MD5 c36369ad7a68e0e9a2994ae68b509980
BLAKE2b-256 c89e7b7a22e19fe30daedb632605739f76f6cf2fd8ade768aa94b764635c0af9

See more details on using hashes here.

File details

Details for the file tmtools-0.0.2-cp39-cp39-win_amd64.whl.

File metadata

  • Download URL: tmtools-0.0.2-cp39-cp39-win_amd64.whl
  • Upload date:
  • Size: 1.5 MB
  • Tags: CPython 3.9, Windows x86-64
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.2-cp39-cp39-win_amd64.whl
Algorithm Hash digest
SHA256 5e313d9971addbb62d77bac0b0fa3c75433cf8f7b998e70510f06dae28c08e56
MD5 bb737c2bff57936548d5a6bb647e0cd5
BLAKE2b-256 90336b0a3d4befe126530ad659935c0560eccb02f00dace8fadd47e0967f9fe7

See more details on using hashes here.

File details

Details for the file tmtools-0.0.2-cp39-cp39-win32.whl.

File metadata

  • Download URL: tmtools-0.0.2-cp39-cp39-win32.whl
  • Upload date:
  • Size: 1.5 MB
  • Tags: CPython 3.9, Windows x86
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.2-cp39-cp39-win32.whl
Algorithm Hash digest
SHA256 7b95119e434c85484c75d77dabddb557f8a6f7b5c02e4b2da97f9634ea87326d
MD5 cdce521c8c9b49c51318f762b0ae5f15
BLAKE2b-256 4e4ef25b0a3a19ef3b795ee8edfd2337b387fcd07b531b522ad75e7e92b703b1

See more details on using hashes here.

File details

Details for the file tmtools-0.0.2-cp39-cp39-manylinux_2_12_x86_64.manylinux2010_x86_64.whl.

File metadata

File hashes

Hashes for tmtools-0.0.2-cp39-cp39-manylinux_2_12_x86_64.manylinux2010_x86_64.whl
Algorithm Hash digest
SHA256 7d689bc90a3ad2c0e7b2902401ba0f91775457b8767294590920b2b1e8166e4e
MD5 67d7c9ad6ff67434d4ec50b5f14d19ca
BLAKE2b-256 cb6b7b43dcceac4f628f9982d60f9768679d4de5f8ef7ecb5bcc9dfdd0b9059c

See more details on using hashes here.

File details

Details for the file tmtools-0.0.2-cp39-cp39-manylinux_2_12_i686.manylinux2010_i686.whl.

File metadata

  • Download URL: tmtools-0.0.2-cp39-cp39-manylinux_2_12_i686.manylinux2010_i686.whl
  • Upload date:
  • Size: 1.6 MB
  • Tags: CPython 3.9, manylinux: glibc 2.12+ i686
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.2-cp39-cp39-manylinux_2_12_i686.manylinux2010_i686.whl
Algorithm Hash digest
SHA256 015e3a0cf63915d93b2f1ab7a785da712b8f3ff2a17d49798a3bf93e64d6cd0d
MD5 572af17e6df6dbd01db52e26df834a02
BLAKE2b-256 de0dc06e8e6b3d278366563b726665fb6b6866d0d2c1814d42b438148c899bb0

See more details on using hashes here.

File details

Details for the file tmtools-0.0.2-cp39-cp39-macosx_11_0_arm64.whl.

File metadata

  • Download URL: tmtools-0.0.2-cp39-cp39-macosx_11_0_arm64.whl
  • Upload date:
  • Size: 1.6 MB
  • Tags: CPython 3.9, macOS 11.0+ ARM64
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.2-cp39-cp39-macosx_11_0_arm64.whl
Algorithm Hash digest
SHA256 f797edb854e3c1366124c89942df82452c5a73c988fbc516a563fbfd1bd696e7
MD5 1828d23918b37fab19b804db8027b6f7
BLAKE2b-256 bfce4ee21d4514a705cb29731d0baea1c73392ffe5176c465b0ae06176f06a68

See more details on using hashes here.

File details

Details for the file tmtools-0.0.2-cp39-cp39-macosx_10_9_x86_64.whl.

File metadata

  • Download URL: tmtools-0.0.2-cp39-cp39-macosx_10_9_x86_64.whl
  • Upload date:
  • Size: 1.6 MB
  • Tags: CPython 3.9, macOS 10.9+ x86-64
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.2-cp39-cp39-macosx_10_9_x86_64.whl
Algorithm Hash digest
SHA256 9ae51bebaf155749abfa992d031124d8c835b4eef143d1c706676038a02fed9e
MD5 f2166ddea37665fce298f2cf5f530927
BLAKE2b-256 e85c2cbfa9f8dcba7fcf5bb4d58cd37fde43b6b008139f51e02dcc42074c9a31

See more details on using hashes here.

File details

Details for the file tmtools-0.0.2-cp38-cp38-win_amd64.whl.

File metadata

  • Download URL: tmtools-0.0.2-cp38-cp38-win_amd64.whl
  • Upload date:
  • Size: 1.5 MB
  • Tags: CPython 3.8, Windows x86-64
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.2-cp38-cp38-win_amd64.whl
Algorithm Hash digest
SHA256 1b7ba3ac284e0d0079be291ee5b3ca72c09b689135b9c7282b135e5850d59d76
MD5 0485c1bbf40dd14cbbd726522e9997df
BLAKE2b-256 fcfd3457baf9a960447805f731c6474a350f0962c57358eb67e681afc43d6405

See more details on using hashes here.

File details

Details for the file tmtools-0.0.2-cp38-cp38-win32.whl.

File metadata

  • Download URL: tmtools-0.0.2-cp38-cp38-win32.whl
  • Upload date:
  • Size: 1.5 MB
  • Tags: CPython 3.8, Windows x86
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.2-cp38-cp38-win32.whl
Algorithm Hash digest
SHA256 cc4b371a681b0083918949a648f97871e9cc658deda4dda5040dc5ade9acf0ed
MD5 197a8e4ee564ca904e369ac3a23d05a7
BLAKE2b-256 83d7a25afd5c760882f22c830fbe370d2cadb2a78613a21edccb351f309f5308

See more details on using hashes here.

File details

Details for the file tmtools-0.0.2-cp38-cp38-manylinux_2_12_x86_64.manylinux2010_x86_64.whl.

File metadata

File hashes

Hashes for tmtools-0.0.2-cp38-cp38-manylinux_2_12_x86_64.manylinux2010_x86_64.whl
Algorithm Hash digest
SHA256 053a5b744278bc0ad14cefd6b88f30f50b6e5b6c933239b61d2ac38691322291
MD5 e114166eccb6861d295e3876639c2312
BLAKE2b-256 7e4f54ef0487636f348bad51d3f1fc56a44df283c47710da1d3139b35fa614f8

See more details on using hashes here.

File details

Details for the file tmtools-0.0.2-cp38-cp38-manylinux_2_12_i686.manylinux2010_i686.whl.

File metadata

  • Download URL: tmtools-0.0.2-cp38-cp38-manylinux_2_12_i686.manylinux2010_i686.whl
  • Upload date:
  • Size: 1.6 MB
  • Tags: CPython 3.8, manylinux: glibc 2.12+ i686
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.2-cp38-cp38-manylinux_2_12_i686.manylinux2010_i686.whl
Algorithm Hash digest
SHA256 801d801a3860f416d71ee17da8c856798c255de9c9710a585a6bb51458ee5980
MD5 128b239e860c610768ebfc420d58a80d
BLAKE2b-256 fc850df54f094e19aac335db9c2f6891f3077fba1acab501eee8e7c9925f6288

See more details on using hashes here.

File details

Details for the file tmtools-0.0.2-cp38-cp38-macosx_11_0_arm64.whl.

File metadata

  • Download URL: tmtools-0.0.2-cp38-cp38-macosx_11_0_arm64.whl
  • Upload date:
  • Size: 1.6 MB
  • Tags: CPython 3.8, macOS 11.0+ ARM64
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.2-cp38-cp38-macosx_11_0_arm64.whl
Algorithm Hash digest
SHA256 a7430964b28d718b2d72d31b14fdfa800b23183be05a920fc96604a5bad75842
MD5 1ccefc11fcd6a4f31e6a0264eb1f8936
BLAKE2b-256 63a3505dcf3cf51fb62c37318174e5cc8129f57c9f0ef51e5bf4a9dd0cf53c94

See more details on using hashes here.

File details

Details for the file tmtools-0.0.2-cp38-cp38-macosx_10_9_x86_64.whl.

File metadata

  • Download URL: tmtools-0.0.2-cp38-cp38-macosx_10_9_x86_64.whl
  • Upload date:
  • Size: 1.6 MB
  • Tags: CPython 3.8, macOS 10.9+ x86-64
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.2-cp38-cp38-macosx_10_9_x86_64.whl
Algorithm Hash digest
SHA256 8de97f4b444f4e23be2810f0e46453fd8a39bc3a34606c97400b55f4fa5db71a
MD5 3874eb59ce2db12719d7bb10358e91d6
BLAKE2b-256 69328fe0e8ce2ca41e07a63de45d3cde0863dc5c6452df4b6241466fd1f45458

See more details on using hashes here.

File details

Details for the file tmtools-0.0.2-cp37-cp37m-win_amd64.whl.

File metadata

  • Download URL: tmtools-0.0.2-cp37-cp37m-win_amd64.whl
  • Upload date:
  • Size: 1.5 MB
  • Tags: CPython 3.7m, Windows x86-64
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.2-cp37-cp37m-win_amd64.whl
Algorithm Hash digest
SHA256 1d4dd54bc04d6faf725df4dcb6acb9def5a56c0e781b7f8799154131f4b3815c
MD5 74db25d638c23a7dbe72afcef7a9bb3c
BLAKE2b-256 50aa2a9ba90551e1bcd53e80bd56f01a12b53affd4f2e69851a94729695e2c40

See more details on using hashes here.

File details

Details for the file tmtools-0.0.2-cp37-cp37m-win32.whl.

File metadata

  • Download URL: tmtools-0.0.2-cp37-cp37m-win32.whl
  • Upload date:
  • Size: 1.5 MB
  • Tags: CPython 3.7m, Windows x86
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.2-cp37-cp37m-win32.whl
Algorithm Hash digest
SHA256 b615babdeb6b96495c5e42e34bf2bacdc34aba45d56f1b8a740c84843d5755f3
MD5 f0eab9b9377bdbb503d4c4d6c0f8b3c3
BLAKE2b-256 8eb7eb765674ec64f17633dd7e15c4a15bd9f87877eb1f444c4d95012d3350f2

See more details on using hashes here.

File details

Details for the file tmtools-0.0.2-cp37-cp37m-manylinux_2_12_x86_64.manylinux2010_x86_64.whl.

File metadata

File hashes

Hashes for tmtools-0.0.2-cp37-cp37m-manylinux_2_12_x86_64.manylinux2010_x86_64.whl
Algorithm Hash digest
SHA256 e420900c6786b4e76cef9861f3e62fc5bc1966f610d4b9f9fe0ff7d1e8bce5cb
MD5 bf8b002825b5518ad17666f9ffbea00b
BLAKE2b-256 393f7745c319c3bdb000273a52a79397fdf8fa99a297a533fb9d9e50dbf32165

See more details on using hashes here.

File details

Details for the file tmtools-0.0.2-cp37-cp37m-manylinux_2_12_i686.manylinux2010_i686.whl.

File metadata

  • Download URL: tmtools-0.0.2-cp37-cp37m-manylinux_2_12_i686.manylinux2010_i686.whl
  • Upload date:
  • Size: 1.6 MB
  • Tags: CPython 3.7m, manylinux: glibc 2.12+ i686
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.2-cp37-cp37m-manylinux_2_12_i686.manylinux2010_i686.whl
Algorithm Hash digest
SHA256 bff3aaeb51d7e7b3618c87df2b84db9dce39e4cbaa359ef6ec00ecc0eadf34c2
MD5 a71d7586321a5ebc3529a432a8aa5aa2
BLAKE2b-256 24130724f1f27a6a2c8b0b6129eb9cb6df2c3151d07ffe1f519696dfff2d6411

See more details on using hashes here.

File details

Details for the file tmtools-0.0.2-cp37-cp37m-macosx_10_9_x86_64.whl.

File metadata

  • Download URL: tmtools-0.0.2-cp37-cp37m-macosx_10_9_x86_64.whl
  • Upload date:
  • Size: 1.6 MB
  • Tags: CPython 3.7m, macOS 10.9+ x86-64
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.2-cp37-cp37m-macosx_10_9_x86_64.whl
Algorithm Hash digest
SHA256 b05648946aceb667f64ded01ac0b604712fd238969eceb8aa353373ce36635f1
MD5 c4de5fe61b52422402d0e7ad4e993d01
BLAKE2b-256 0a4b894cb10fc539daf7916e4001d4aa5b8c6612db06e9a913e509915b7bc646

See more details on using hashes here.

File details

Details for the file tmtools-0.0.2-cp36-cp36m-win_amd64.whl.

File metadata

  • Download URL: tmtools-0.0.2-cp36-cp36m-win_amd64.whl
  • Upload date:
  • Size: 1.5 MB
  • Tags: CPython 3.6m, Windows x86-64
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.2-cp36-cp36m-win_amd64.whl
Algorithm Hash digest
SHA256 a236f485447248f31a7869ae322936cf0477bb96063c899ce30b0f822845641c
MD5 b926b7bb63d778f6729ca0d1d06756a1
BLAKE2b-256 a2ac0c26a6b6af9acf8c2e43564f970b54b2d3a075185fb4574b8ec7a6b507de

See more details on using hashes here.

File details

Details for the file tmtools-0.0.2-cp36-cp36m-win32.whl.

File metadata

  • Download URL: tmtools-0.0.2-cp36-cp36m-win32.whl
  • Upload date:
  • Size: 1.5 MB
  • Tags: CPython 3.6m, Windows x86
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.2-cp36-cp36m-win32.whl
Algorithm Hash digest
SHA256 eb255a8f32f6dea5376838d606418d5562579836b3443d1827039f1d6d137eaf
MD5 155425e47461fd3afe921ec80149f249
BLAKE2b-256 591e9dfe97291ee288b72d39952129e6091738b2a7a4e0d1599102571eaeb1ae

See more details on using hashes here.

File details

Details for the file tmtools-0.0.2-cp36-cp36m-manylinux_2_12_x86_64.manylinux2010_x86_64.whl.

File metadata

File hashes

Hashes for tmtools-0.0.2-cp36-cp36m-manylinux_2_12_x86_64.manylinux2010_x86_64.whl
Algorithm Hash digest
SHA256 07b9e16fe21107c3c17bef302f7b2894ac5f28e0103f4da5dba0bd0d796f1851
MD5 169811d872f101cc7c9e058f71e329c4
BLAKE2b-256 9385b6b1b5df0d5362dc7c20bbae9e9837ea15cab67bed7d5135909c05917cc3

See more details on using hashes here.

File details

Details for the file tmtools-0.0.2-cp36-cp36m-manylinux_2_12_i686.manylinux2010_i686.whl.

File metadata

  • Download URL: tmtools-0.0.2-cp36-cp36m-manylinux_2_12_i686.manylinux2010_i686.whl
  • Upload date:
  • Size: 1.6 MB
  • Tags: CPython 3.6m, manylinux: glibc 2.12+ i686
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.2-cp36-cp36m-manylinux_2_12_i686.manylinux2010_i686.whl
Algorithm Hash digest
SHA256 4d7aa8ba54a45a7f97416ce037c9fb16e91f1d22579a8ac0939990c5e30a156b
MD5 b785a7e43497cda79dba0a14528eac60
BLAKE2b-256 f707e2b8637f96125bd5c1e25a20d0e1bb8af12b67bd407b20d178f13c97cd25

See more details on using hashes here.

File details

Details for the file tmtools-0.0.2-cp36-cp36m-macosx_10_9_x86_64.whl.

File metadata

  • Download URL: tmtools-0.0.2-cp36-cp36m-macosx_10_9_x86_64.whl
  • Upload date:
  • Size: 1.6 MB
  • Tags: CPython 3.6m, macOS 10.9+ x86-64
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/4.10.0 pkginfo/1.8.2 requests/2.26.0 requests-toolbelt/0.9.1 tqdm/4.62.3 CPython/3.9.9

File hashes

Hashes for tmtools-0.0.2-cp36-cp36m-macosx_10_9_x86_64.whl
Algorithm Hash digest
SHA256 32877b135269be5769a1ac68f1a20997251c0134acf1bf43b0ae70493b99960d
MD5 bcb34a1049430ed7e53feb116cde161b
BLAKE2b-256 2d4b65ecfd40dc7ae532792c6952af9b967a5255f838cf440d68fbe2ffa9c734

See more details on using hashes here.

Supported by

AWS Cloud computing and Security Sponsor Datadog Monitoring Depot Continuous Integration Fastly CDN Google Download Analytics Pingdom Monitoring Sentry Error logging StatusPage Status page