Skip to main content

DeepTpTools

Protein prediction package

Environmental installation

Model Download

You can download the model in the following two ways:

  1. https://drive.google.com/drive/folders/1OEKabeJmdGiGG1PJsPu0bgcE5_GVGXc9?usp=share_link
  2. https://luke9012.lanzoub.com/b00r1vhre | password:ddpt

After the download is completed, pass in the folder path p = DeepTp(r'D:\_code\_github\DeepTpTools\drop')

R

R language version requires version 4.1.3 or higher Two packages need to be installed simultaneously:

install.packages("protr")
install.packages("DT")

Set SimultaneouslyR_HOMEto environment variable

Python

Python version requires3.6or higher

How to use

If there is a protein sequence

name = "Q4JB77"
seq = "MRAAVLEEYKKPLRISEVDSPSINESSEVLLQVTATGLCHGDIHIAMGEWDSQIQVNLPIILGHEVVGRVLQSNHDKIKKNDLVLVYNAFGCKNCKYCKFKEYQFCEKVKVIGVNLNGGFAEYVKIPDGDNLVRVNTSDPIKLAPLADAGLTAYNSVKDLEENSKVLIIGTGAVALIALQLLKLKNVDVTVIGENQLKLDSAEKLGADEVISIKREEDSYLSLLPGKKFDYILDYVGSTRTLAESPWLLNKKGELRIIGEFGGVLRAEEQLLVLRGLRIRGILYGSLQDLKHILDIYLKGKIDTLTTVYKLEDINEAITDVTEGKVVGRAVIVP"
p = DeepTp(r'D:\_code\_github\ProTstab2\drop')
r, r2 = p.predict(name, seq)
print(r, r2)
# 0.8722285 Thermophilic protein

If there is no protein sequence, the following methods can be used

Method 1:

name = "Q4JB77"
p = DeepTp(r'D:\_code\_github\ProTstab2\drop')
seq = p.get_seq_info(name)
r, r2 = p.predict(name, seq)
print(r, r2)
# 0.8722285 Thermophilic protein

Method 2:

name = "Q4JB77"
p = DeepTp(r'D:\_code\_github\ProTstab2\drop')
r, r2 = p.predict(name)
print(r, r2)
# 0.8722285 Thermophilic protein

The first method is recommended here for the following reasons:

  1. Due to the use of crawlers, it is not guaranteed that data can be obtained every time, and the program may crash
  2. You can obtain specific protein sequence values

Disclaimers

The applications involved in this package are for learning and communication purposes only and shall not be used for any commercial purposes. Any legal disputes arising from this have nothing to do with me!

Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

DeepTpTools-1.0.4.tar.gz (7.4 kB view details)

Uploaded Source

File details

Details for the file DeepTpTools-1.0.4.tar.gz.

File metadata

  • Download URL: DeepTpTools-1.0.4.tar.gz
  • Upload date:
  • Size: 7.4 kB
  • Tags: Source
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/3.7.1 importlib_metadata/6.6.0 pkginfo/1.9.6 requests/2.24.0 requests-toolbelt/1.0.0 tqdm/4.65.0 CPython/3.8.10

File hashes

Hashes for DeepTpTools-1.0.4.tar.gz
Algorithm Hash digest
SHA256 a94f6706fcddee94e1ec0386c90445e53ba5d90d0d1820e5e4bc39ed577699e0
MD5 30a2b980c351a6daaa52da7667adb679
BLAKE2b-256 53f14d8f6da54a184301afc1a20c71165e16498f31985ba8e130df7ea598a76b

See more details on using hashes here.

Release history Release notifications | RSS feed

This release

1.0.4 This release

1 file

Anthropic, PBC Visionary sponsor Bloomberg Visionary sponsor Hudson River Trading Visionary sponsor Meta Visionary sponsor NVIDIA Visionary sponsor Microsoft Sustainability sponsor Depot Continuous Integration AWS Cloud computing and Security Sponsor Datadog Monitoring Fastly CDN Google Download Analytics Sentry Error logging StatusPage Status page