DeepTpTools 1.0.4

Protein prediction package

DeepTpTools

Protein prediction package

Environmental installation

Model Download

You can download the model in the following two ways:

1. https://drive.google.com/drive/folders/1OEKabeJmdGiGG1PJsPu0bgcE5_GVGXc9?usp=share_link
2. https://luke9012.lanzoub.com/b00r1vhre | password:ddpt

After the download is completed, pass in the folder path p = DeepTp(r'D:\_code\_github\DeepTpTools\drop')

R

R language version requires version 4.1.3 or higher Two packages need to be installed simultaneously:

install.packages("protr")
install.packages("DT")

Set SimultaneouslyR_HOMEto environment variable

Python

Python version requires3.6or higher

How to use

If there is a protein sequence

name = "Q4JB77"
seq = "MRAAVLEEYKKPLRISEVDSPSINESSEVLLQVTATGLCHGDIHIAMGEWDSQIQVNLPIILGHEVVGRVLQSNHDKIKKNDLVLVYNAFGCKNCKYCKFKEYQFCEKVKVIGVNLNGGFAEYVKIPDGDNLVRVNTSDPIKLAPLADAGLTAYNSVKDLEENSKVLIIGTGAVALIALQLLKLKNVDVTVIGENQLKLDSAEKLGADEVISIKREEDSYLSLLPGKKFDYILDYVGSTRTLAESPWLLNKKGELRIIGEFGGVLRAEEQLLVLRGLRIRGILYGSLQDLKHILDIYLKGKIDTLTTVYKLEDINEAITDVTEGKVVGRAVIVP"
p = DeepTp(r'D:\_code\_github\ProTstab2\drop')
r, r2 = p.predict(name, seq)
print(r, r2)
# 0.8722285 Thermophilic protein

If there is no protein sequence, the following methods can be used

Method 1：

name = "Q4JB77"
p = DeepTp(r'D:\_code\_github\ProTstab2\drop')
seq = p.get_seq_info(name)
r, r2 = p.predict(name, seq)
print(r, r2)
# 0.8722285 Thermophilic protein

Method 2：

name = "Q4JB77"
p = DeepTp(r'D:\_code\_github\ProTstab2\drop')
r, r2 = p.predict(name)
print(r, r2)
# 0.8722285 Thermophilic protein

The first method is recommended here for the following reasons：

1. Due to the use of crawlers, it is not guaranteed that data can be obtained every time, and the program may crash
2. You can obtain specific protein sequence values

Disclaimers

The applications involved in this package are for learning and communication purposes only and shall not be used for any commercial purposes. Any legal disputes arising from this have nothing to do with me!