Skip to main content

A package for simulating biomolecules on a lattice.

Project description

LatticePy

A python package for MCMC simulations of folding and phase separation in biomolecules on a lattice. LatticePy currently supports the simulation of amino acids and protein polymers on a lattice with any given number of units.

Installation

Stable Release

Run the following command in bash:

pip3 install LatticePy

Developers Release

Run the following command in bash:

pip3 install git+https://github.com/sohitmiglani/LatticePy#egg=LatticePy

Tutorial

- Import the package and initialize the lattice. You can customize the bounds of the lattice, the compactness energy, the beta (1/Temperature), and the lattice type.

from LatticePy import lattice
mylattice = lattice(bound=50, E_c=1.5, beta=0, lattice_type='simple_cubic')

- Add your polymer

  • By a list of polarities
polymer = [-1, -1, -1, 1, 1, -1, -1, 1, -1, -1, -1, -1, 1, -1, 1, 1, 1, -1, 1, -1, 1, -1, 1, 1, 1, -1, -1]
mylattice.add_polymer(polymer, n_polymers=1, placement='straight') # to add it in a straight line
mylattice.add_polymer(polymer, n_polymers=1, placement='randomly') # to add it in a random fashion which may cause knots
  • By sequence
sequence = 'MTKSHSEEVIVPEFNSSAKELPRPLAEKCPSIIKKFISAYDAKPDFVARSPGRVNLIGEH'
mylattice.add_protein(sequence, type='straight', n_polymers=1)

- Simulate your polymers with annealing

Change the parameters as you see fit

mylattice.simulate(n_mcmc=200000, 
                   interval=1000, 
                   record_intervals = True, 
                   anneal=True, 
                   beta_lower_bound=0, 
                   beta_upper_bound=2, 
                   beta_interval=0.05)

- Visualize the energy variation over all the MCMC steps

mylattice.energy_variation_graph()

- Visualize in an interactive 3-D lattice

mylattice.visualize()

You can see the interactive 3-D lattice for this run here.

- Get important statistics

mylattice.native_contacts

20

mylattice.energy

-58.7

mylattice.non_covalent_hydrophobic_contacts

9

Project details


Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

latticepy-0.3.2.tar.gz (91.6 kB view details)

Uploaded Source

Built Distribution

If you're not sure about the file name format, learn more about wheel file names.

latticepy-0.3.2-py3-none-any.whl (12.6 kB view details)

Uploaded Python 3

File details

Details for the file latticepy-0.3.2.tar.gz.

File metadata

  • Download URL: latticepy-0.3.2.tar.gz
  • Upload date:
  • Size: 91.6 kB
  • Tags: Source
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/5.1.1 CPython/3.12.4

File hashes

Hashes for latticepy-0.3.2.tar.gz
Algorithm Hash digest
SHA256 1820b0524735df35f0d0e553eb9343900dc11a9d3835953a59f48e8ec3b4a54f
MD5 aca4b285b2b23416460c4a8789115d50
BLAKE2b-256 0378463d4de4e1cdf22862d2bab7da7492f16f9e1afca83445b0faeda3c1f221

See more details on using hashes here.

File details

Details for the file latticepy-0.3.2-py3-none-any.whl.

File metadata

  • Download URL: latticepy-0.3.2-py3-none-any.whl
  • Upload date:
  • Size: 12.6 kB
  • Tags: Python 3
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/5.1.1 CPython/3.12.4

File hashes

Hashes for latticepy-0.3.2-py3-none-any.whl
Algorithm Hash digest
SHA256 105c2c89739800852f181da6d1cedd606d6f0a160d7c454aad927d6942949e17
MD5 51a2f312e29d74c9f4f0b8a213450ad1
BLAKE2b-256 2dae9081f68313433a061217d1ea6c32434c57ff4dcd24fe21a3e05a356a2826

See more details on using hashes here.

Supported by

AWS Cloud computing and Security Sponsor Datadog Monitoring Depot Continuous Integration Fastly CDN Google Download Analytics Pingdom Monitoring Sentry Error logging StatusPage Status page