Skip to main content
ANARCI                                                 \\    //
Antibody Numbering and Antigen Receptor ClassIfication  \\  //
                                                          ||
(c) Oxford Protein Informatics Group (OPIG). 2015-20      ||

Author: James Dunbar (dunbar@stats.ox.ac.uk)
        Charlotte Deane (deane@stats.ox.ac.uk)

Contact: opig@stats.ox.ac.uk

Usage:

  • Numbering a single sequence
ANARCI -i EVQLQQSGAEVVRSGASVKLSCTASGFNIKDYYIHWVKQRPEKGLEWIGWIDPEIGDTEYVPKFQGKATMTADTSSNTAYLQLSSLTSEDTAVYYCNAGHDYDRGRFPYWGQGTLVTVSA
  • Numbering sequences in a FASTA file
ANARCI -i myfile.fasta 
  • Please note that while ANARCI uses alignment to species V and J germlines to determine the species of the antibody for purposes of numbering, we do not recommend using ANARCI as your primary species annotation tool

Installation

The easiest way to install ANARCI and its dependencies is using conda

conda install -c conda-forge biopython -y
conda install -c bioconda hmmer=3.3.2 -y
cd ANARCI
python setup.py install

Further info

Output files

  • The numbering file.

The numbering file (--outfile or stdout) reports the numbering for all sequences given in the sequence file. Each record is separated by "//". Those chains for which no significant alignment was found report the name as in the fasta file. e.g:

# 1A14:N|PDBID|CHAIN|SEQUENCE
//
     
    Those sequences where a significant alignment has been found report as below: 
    
# 1A14:H|PDBID|CHAIN|SEQUENCE
# ANARCI numbered
# Domain 1 of 1
# Most significant HMM hit
#|species|chain_type|e-value|score|seqstart_index|seqend_index|
#|mouse|H|8.6e-58|184.9|0|119|
# Scheme = imgt
H 1       Q
H 2       V
H 3       Q
H 4       L
H 5       Q
  . 
  .
  .
//

    where:
    species          = The species of the most significant aligned HMM
    chain_type       = The chain type of the most significant aligned HMM
    e-value          = The e-value of the alignment to the most significant aligned HMM
    score            = The bit-score of the alignment to the most significant aligned HMM
    seqstart_index   = The index in the sequence of the first numbered residue
    seqend_index     = The index in the sequence of the last numbered residue
    Scheme           = The numbering scheme used to number the sequence
    
    Then follows the numbering. Chain type (H, L (for both kappa(K) and lambda(L) chain types) , A (alpha), B (beta))

    If the "assign_germline" option has been specified the further following lines are added to the header. e.g.

# Most sequence-identical germlines
#|species|v_gene|v_identity|j_gene|j_identity|
#|mouse|IGHV1-12*01|0.86|IGHJ2*01|0.79|

    where:
    species          = The species of the most sequence identical germline
    v_gene           = The identifier of the most sequence identical germline over the v-region
    v_identity       = The sequence identity over the v-region to the most sequence identical germline
    j_gene           = The identifier of the most sequence identical germline over the j-region
    j_identity       = The sequence identity over the j-region to the most sequence identical germline
  • The csv format output file.

    When the --csv option is specified, numbered sequences are output into separate comma separated value files depending on their chain type. This provides a horizontal output format and contains all the properties detailed above. In addition, sequences are aligned according to the numbering scheme.

  • The hit file.

    The hit file reports the statistics for all alignments to each HMM in the database even if the sequence was not numbered. Each record is separated by "//".

    The corresponding hit table for the numbered entry above looks like:

    """
        NAME     1a14_H mol:protein length:120  NC10 FV (HEAVY CHAIN)
    SEQUENCE QVQLQQSGAELVKPGASVRMSCKASGYTFTNYNMYWVKQSPGQGLEWIGIFYPGNGDTSYNQKFKDKATLT
    SEQUENCE ADKSSNTAYMQLSSLTSEDSAVYYCARSGGSYRYDGGFDYWGQGTTVTV
                   id       description            evalue          bitscore              bias   best_dom_evalue best_dom_bitscore     best_dom_bias    domain_exp_num    domain_obs_num
              mouse_H                             1.1e-57             184.5               1.5           1.3e-57             184.4               1.5               1.0                 1
              human_H                             7.8e-53             169.0               1.9           8.7e-53             168.8               1.9               1.0                 1
                rat_H                             4.7e-47             150.2               2.2           5.2e-47             150.0               2.2               1.0                 1
             rabbit_H                             3.7e-37             118.2               0.7             4e-37             118.1               0.7               1.0                 1
                pig_H                             1.5e-35             113.3               2.7           1.6e-35             113.1               2.7               1.0                 1
             rhesus_H                             4.4e-32             101.5               1.8           4.9e-32             101.4               1.8               1.0                 1
              mouse_B                             2.4e-19              60.6               0.7           2.6e-19              60.5               0.7               1.0                 1
              human_B                             4.2e-19              59.7               0.9           4.6e-19              59.5               0.9               1.0                 1
              mouse_A                             8.7e-19              58.5               1.1           9.6e-19              58.4               1.1               1.0                 1
              human_A                             1.7e-18              57.6               0.9           1.9e-18              57.5               0.9               1.0                 1
              mouse_D                             5.1e-17              53.3               0.7           5.9e-17              53.1               0.7               1.1                 1
             rhesus_L                             1.6e-16              51.7               2.7           1.9e-16              51.4               2.7               1.1                 1
              human_L                             1.7e-15              48.3               3.5             2e-15              48.0               3.5               1.1                 1
              human_D                             6.7e-15              46.1               0.2           7.4e-15              45.9               0.2               1.0                 1
             rhesus_K                             3.9e-13              40.6               1.7           5.1e-13              40.2               1.7               1.2                 1
              mouse_G                             4.1e-13              40.3               0.0           4.3e-13              40.2               0.0               1.0                 1
             rabbit_L                             6.1e-13              40.0               2.8           8.1e-13              39.6               2.8               1.2                 1
                rat_K                             3.9e-12              37.4               1.4           4.4e-12              37.2               1.4               1.1                 1
                pig_L                             4.2e-12              37.5               1.0           4.7e-12              37.3               1.0               1.1                 1
              mouse_K                             1.2e-11              35.7               2.6           1.3e-11              35.6               2.6               1.1                 1
              human_K                             2.2e-11              34.8               2.9           3.5e-11              34.2               2.9               1.4                 1
              mouse_L                             1.9e-10              31.8               2.2           3.4e-10              30.9               2.2               1.4                 1
                rat_L                             2.5e-10              31.7               1.2           2.9e-10              31.5               1.2               1.1                 1
                pig_K                             3.2e-10              31.1               1.9           4.5e-10              30.6               1.9               1.3                 1
              human_G                             2.9e-09              27.8               0.8           4.9e-09              27.1               0.8               1.4                 1
             rabbit_K                             2.5e-06              18.4               5.8           4.2e-06              17.7               5.8               1.4                 1
    //
    """

We therefore get a ranking of the alignments to each chain type.

Schemes:

  • Currently implemented schemes: IMGT Chothia (IGs only) Kabat (IGs only) Martin / Enhanced Chothia (IGs only) AHo Wolfguy (IGs only)

  • Currently recognisable species (chains): Human (heavy, kappa, lambda, alpha, beta) Mouse (heavy, kappa, lambda, alpha, beta) Rat (heavy, kappa, lambda) Rabbit (heavy, kappa, lambda) Pig (heavy, kappa, lambda) Rhesus Monkey (heavy, kappa)

Other species may still be numbered correctly and the chain type recognised but the species be incorrect. e.g. llama VHH.

  • IMGT - has 128 possible positions for all antigen receptor types. These are supposed to be structurally equivalent. In theory these are supposed to account for all possible positions. However, insertions are possible especially at CDR3. ANARCI gives the insertion codes as letters. Insertions at CDR3 are placed symmetrically about imgt positions 111 and 112. e.g. 111-ABCD DCBA-112.

  • Kabat - is defined for heavy and light chain antibody chains only (in ANARCI). Positions in the two chain types are not equivalent. Insertions occur at specific positions and can occur in both the framework and the CDRs. They are annotated from A->Z. e.g 100ABCDEFGH 101.

  • Chothia - is defined for heavy and light chain antibody chains only (in ANARCI). Numbering in the two chain types are not equivalent. Insertions occur at specific positions and can occur in both the framework and the CDRs. They are annotated from A->Z. e.g 100ABCDEFGH 101. It differs to the Kabat scheme by the position it places the insertions at CDRH1.

  • Martin - is defined for heavy and light chain antibody chains only. Numbering in the two chain types are not equivalent. Insertions occur at specific positions and can occur in both the framework and the CDRs. They are annotated from A->Z. e.g 100ABCDEFGH 101. It differs to the Chothia scheme by the position it places the certain insertions in the framework. It is also referred to as the enhanced Chothia scheme.

  • AHo - has 149 possible for all antigen receptor types. These are supposed to be structurally equivalent. The AHo scheme's large number of positions is supposed to account for all possible positions without the need for specifying insertion positions. In ANARCI, extra residues in the framework may be represented by insertions although these are unlikely to occur in natural sequences.

  • Wolfguy - is defined for heavy and light antibody chains. Numbering in the two chain types are not equivalent. Different regions of the domain are denoted by a range of numbers. Many possible positions in the CDRs mean that insertion codes are not required. In ANARCI, extra residues in the framework may be represented by insertions although these are unlikely to occur in natural sequences. The CDRs are numbered in an 'up' and 'down' direction. The annotations of CDRL1 is defined according to the canonical structure. In ANARCI this is recognised by taking a sequence similarity to hard coded sequence motifs for different lengths.

Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

anarci-2026.2.13.2.tar.gz (2.3 MB view details)

Uploaded Source

Built Distribution

If you're not sure about the file name format, learn more about wheel file names.

anarci-2026.2.13.2-py3-none-any.whl (1.2 MB view details)

Uploaded Python 3

File details

Details for the file anarci-2026.2.13.2.tar.gz.

File metadata

  • Download URL: anarci-2026.2.13.2.tar.gz
  • Upload date:
  • Size: 2.3 MB
  • Tags: Source
  • Uploaded using Trusted Publishing? Yes
  • Uploaded via: twine/6.1.0 CPython/3.13.7

File hashes

Hashes for anarci-2026.2.13.2.tar.gz
Algorithm Hash digest
SHA256 0b383e7abd2c4f65231f15b1b80cad6b8aad223c693c90c173b8b062da3d493b
MD5 9932d8db07a334a43fd005cc2e12be13
BLAKE2b-256 a2318db2bb1f75c54a774129b02a7c81377809c4486fefdde0ff8d9fd3f8d1a3

See more details on using hashes here.

Provenance

The following attestation bundles were made for anarci-2026.2.13.2.tar.gz:

Publisher: release.yml on jnooree/ANARCI

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

File details

Details for the file anarci-2026.2.13.2-py3-none-any.whl.

File metadata

  • Download URL: anarci-2026.2.13.2-py3-none-any.whl
  • Upload date:
  • Size: 1.2 MB
  • Tags: Python 3
  • Uploaded using Trusted Publishing? Yes
  • Uploaded via: twine/6.1.0 CPython/3.13.7

File hashes

Hashes for anarci-2026.2.13.2-py3-none-any.whl
Algorithm Hash digest
SHA256 8f88d49857abc2c5427c6cc903ebdac7b35e6636635eaa9d60bd8f0d4e7d14b7
MD5 7e935b34c9a10ecc50eba2564ded4739
BLAKE2b-256 1e501345543216a281cab84030a73ee4918b87e7249679926392d8fa44cb9420

See more details on using hashes here.

Provenance

The following attestation bundles were made for anarci-2026.2.13.2-py3-none-any.whl:

Publisher: release.yml on jnooree/ANARCI

Attestations: Values shown here reflect the state when the release was signed and may no longer be current.

Release history Release notifications | RSS feed

This release

2026.2.13.2 This release

2 files

2026.2.13.1

2 files

2026.2.13.0

2 files

Anthropic, PBC Visionary sponsor Bloomberg Visionary sponsor Hudson River Trading Visionary sponsor Meta Visionary sponsor NVIDIA Visionary sponsor Microsoft Sustainability sponsor Depot Continuous Integration AWS Cloud computing and Security Sponsor Datadog Monitoring Fastly CDN Google Download Analytics Sentry Error logging StatusPage Status page