NeuroPred-PLM: an interpretable and robust model for prediction of neuropeptides by protein language model
Requirements
To install requirements:
# latest version
pip install git+https://github.com/ISYSLAB-HUST/NeuroPred-PLM.git
# stable version
pip install NeuroPredPLM
Usage 
import torch
from NeuroPredPLM.predict import predict
data = [
("peptide_1", "IGLRLPNMLKF"),
("peptide_2", "QAAQFKVWSASELVD"),
("peptide_3","LRSPKMMHKSGCFGRRLDRIGSLSGLGCNVLRKY")
]
device = "cuda" if torch.cuda.is_available() else "cpu"
neuropeptide_pred = predict(data,device)
# {peptide_id:[Type:int(1->neuropeptide,0->non-neuropeptide), attention score:nd.array]}
License
Released under the MIT license.
Contact
If you have any questions, comments, or would like to report a bug, please file a Github issue or contact me at wanglei94@hust.edu.cn.
1 maintainer
Metadata
1 maintainer
Release files for NeuroPredPLM 0.1.0
For a detailed explanation of source distributions (sdists) and built distributions (wheels), please see the package formats documentation.
Source distribution (sdist)
| File | Size | Uploaded | Provenance | Actions |
|---|---|---|---|---|
| NeuroPredPLM-0.1.0.tar.gz | 7.1 kB | Without provenance | Details for NeuroPredPLM-0.1.0.tar.gz |
Built distribution (wheel)
| File | Interpreter | ABI | Platform | Actions Reset |
|---|---|---|---|---|
| NeuroPredPLM-0.1.0-py3-none-any.whl | Python 3 | none | any | Details for NeuroPredPLM-0.1.0-py3-none-any.whl |
Total release size: 14.9 kB
Release files / NeuroPredPLM-0.1.0.tar.gz
| Download URL | NeuroPredPLM-0.1.0.tar.gz |
|---|---|
| Size | 7.1 kB |
| Tags | Source |
|
SHA-256 checksum How to use checksums |
26006c65b7bf64647b6240baab8f607caa113ba558f8674a040fb6d12c7e31d5
|
|
BLAKE2b-256 checksum How to use checksums |
575c092c15faaee7c366ecec9adedd0c5924bf76b2cde33b3ba25b20fb3af853
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
No |
| Uploaded via |
twine/4.0.1 CPython/3.9.13
|
Release files / NeuroPredPLM-0.1.0-py3-none-any.whl
| Download URL | NeuroPredPLM-0.1.0-py3-none-any.whl |
|---|---|
| Size | 7.8 kB |
| Tags | Python 3 |
|
SHA-256 checksum How to use checksums |
eeffba51b7ee23d85a98d09358238acdea6a9535d44e961f3765b6737632a8fb
|
|
BLAKE2b-256 checksum How to use checksums |
80de74e7854ffc592b64a855a0fcd9087ab4060d637aa447da7d9ce0784ec8e0
|
| Upload date | |
|
Uploaded using Trusted Publishing? What is trusted publishing? |
No |
| Uploaded via |
twine/4.0.1 CPython/3.9.13
|
Security for NeuroPredPLM 0.1.0
Provenance
Provenance describes where a file came from. On PyPI, provenance is shared via attestations, which provide a verifiable record of the build or publishing details. View details, limitations and caveats.
No provenance found
None of the files in this release were uploaded with provenance metadata.
A note on package security
PyPI is a repository for distributing packages, not a service for auditing them. While third-party security researchers and our staff do their best to detect and remove malicious packages, PyPI cannot guarantee the quality, security or suitability of any given package.
To learn more about protecting yourself from malicious actors, visit our package security documentation.
