Skip to main content

NeuroPred-PLM: an interpretable and robust model for prediction of neuropeptides by protein language model

PyPI - Version PyPI - Python Version GitHub - LICENSE PyPI - Downloads

Requirements

To install requirements:

# latest version
pip install git+https://github.com/ISYSLAB-HUST/NeuroPred-PLM.git
# stable version
pip install NeuroPredPLM

Usage

import torch
from NeuroPredPLM.predict import predict
data = [
    ("peptide_1", "IGLRLPNMLKF"),
    ("peptide_2", "QAAQFKVWSASELVD"),
    ("peptide_3","LRSPKMMHKSGCFGRRLDRIGSLSGLGCNVLRKY")
]

device = "cuda" if torch.cuda.is_available() else "cpu" 
neuropeptide_pred = predict(data,device)
# {peptide_id:[Type:int(1->neuropeptide,0->non-neuropeptide), attention score:nd.array]}

License

Released under the MIT license.

Contact

If you have any questions, comments, or would like to report a bug, please file a Github issue or contact me at wanglei94@hust.edu.cn.

Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

NeuroPredPLM-0.1.0.tar.gz (7.1 kB view details)

Uploaded Source

Built Distribution

If you're not sure about the file name format, learn more about wheel file names.

NeuroPredPLM-0.1.0-py3-none-any.whl (7.8 kB view details)

Uploaded Python 3

File details

Details for the file NeuroPredPLM-0.1.0.tar.gz.

File metadata

  • Download URL: NeuroPredPLM-0.1.0.tar.gz
  • Upload date:
  • Size: 7.1 kB
  • Tags: Source
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/4.0.1 CPython/3.9.13

File hashes

Hashes for NeuroPredPLM-0.1.0.tar.gz
Algorithm Hash digest
SHA256 26006c65b7bf64647b6240baab8f607caa113ba558f8674a040fb6d12c7e31d5
MD5 b5d34bc1e4c89a7173ce067f3f00a7aa
BLAKE2b-256 575c092c15faaee7c366ecec9adedd0c5924bf76b2cde33b3ba25b20fb3af853

See more details on using hashes here.

File details

Details for the file NeuroPredPLM-0.1.0-py3-none-any.whl.

File metadata

  • Download URL: NeuroPredPLM-0.1.0-py3-none-any.whl
  • Upload date:
  • Size: 7.8 kB
  • Tags: Python 3
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/4.0.1 CPython/3.9.13

File hashes

Hashes for NeuroPredPLM-0.1.0-py3-none-any.whl
Algorithm Hash digest
SHA256 eeffba51b7ee23d85a98d09358238acdea6a9535d44e961f3765b6737632a8fb
MD5 6fd8d52f52f126e436c31c1902060ca1
BLAKE2b-256 80de74e7854ffc592b64a855a0fcd9087ab4060d637aa447da7d9ce0784ec8e0

See more details on using hashes here.

Release history Release notifications | RSS feed

This release

0.1.0 This release

2 files

Anthropic, PBC Visionary sponsor Bloomberg Visionary sponsor Hudson River Trading Visionary sponsor Meta Visionary sponsor NVIDIA Visionary sponsor Microsoft Sustainability sponsor Depot Continuous Integration AWS Cloud computing and Security Sponsor Datadog Monitoring Fastly CDN Google Download Analytics Sentry Error logging StatusPage Status page