Skip to main content

protein language model

Project description

ProtFlash: A lightweight protein language model

PyPI - Version PyPI - Python Version GitHub - LICENSE PyPI - Downloads Wheel build

Install

As a prerequisite, you must have PyTorch installed to use this repository.

You can use this one-liner for installation, using the latest release version

# latest version
pip install git+https://github.com/isyslab-hust/ProtFlash

# stable version
pip install ProtFlash

Model details

Model # of parameters # of hidden size Pretraining dataset # of proteins Model download
ProtFlash-base 174M 768 UniRef100 51M ProtFlash-base
ProtFlash-small 79M 512 UniRef50 51M ProtFlash-small

Usage

protein sequence embedding

from ProtFlash.pretrain import load_prot_flash_base
from ProtFlash.utils import batchConverter
data = [
    ("protein1", "MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG"),
    ("protein2", "KALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLQEE"),
]
ids, batch_token, lengths = batchConverter(data)
model = load_prot_flash_base()
with torch.no_grad():
    token_embedding = model(batch_token, lengths)
# Generate per-sequence representations via averaging
sequence_representations = []
for i, (_, seq) in enumerate(data):
    sequence_representations.append(token_embedding[i, 0: len(seq) + 1].mean(0))

loading weight files

import torch
from ProtFlash.model import FLASHTransformer

model_data = torch.load(your_parameters_file)
hyper_parameter = model_data["hyper_parameters"]
model = FLASHTransformer(hyper_parameter['dim'], hyper_parameter['num_tokens'], hyper_parameter         ['num_layers'], group_size=hyper_parameter['num_tokens'],
                             query_key_dim=hyper_parameter['qk_dim'], max_rel_dist=hyper_parameter['max_rel_dist'], expansion_factor=hyper_parameter['expansion_factor'])

model.load_state_dict(model_data['state_dict'])

License

This source code is licensed under the MIT license found in the LICENSE file in the root directory of this source tree.

Citation

If you use this code or one of our pretrained models for your publication, please cite our paper:

Lei Wang, Hui Zhang, Wei Xu, Zhidong Xue, and Yan Wang. ProtFlash: Deciphering the protein landscape with a novel and lightweight language model, Under revision (2023)

Project details


Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

ProtFlash-0.1.1.tar.gz (6.5 kB view details)

Uploaded Source

Built Distribution

If you're not sure about the file name format, learn more about wheel file names.

ProtFlash-0.1.1-py3-none-any.whl (7.4 kB view details)

Uploaded Python 3

File details

Details for the file ProtFlash-0.1.1.tar.gz.

File metadata

  • Download URL: ProtFlash-0.1.1.tar.gz
  • Upload date:
  • Size: 6.5 kB
  • Tags: Source
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/4.0.2 CPython/3.9.17

File hashes

Hashes for ProtFlash-0.1.1.tar.gz
Algorithm Hash digest
SHA256 de8eb7ab3ceae2858ad6e6ee6746b8be94b235c0f59fa81674e3fd1d68317d22
MD5 2cb9eed190b9a3dfaca9cea9d2fd7356
BLAKE2b-256 8ef1d7cbe20c911dea4e93b6711af96775458e1b18fe94fbf5f7632392927c5d

See more details on using hashes here.

File details

Details for the file ProtFlash-0.1.1-py3-none-any.whl.

File metadata

  • Download URL: ProtFlash-0.1.1-py3-none-any.whl
  • Upload date:
  • Size: 7.4 kB
  • Tags: Python 3
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/4.0.2 CPython/3.9.17

File hashes

Hashes for ProtFlash-0.1.1-py3-none-any.whl
Algorithm Hash digest
SHA256 6dbcf564e0962c6310ef572f2b5902698e570a73c12d457491fb73d95b6bfe49
MD5 2d43095e9233fbe0111b4c25208bea41
BLAKE2b-256 c5aad637a378b05fcfec846fb265fa87ceb9aa4edfed7f62cbe8261fe7d1e71e

See more details on using hashes here.

Supported by

AWS Cloud computing and Security Sponsor Datadog Monitoring Depot Continuous Integration Fastly CDN Google Download Analytics Pingdom Monitoring Sentry Error logging StatusPage Status page