AbLang2: An antibody-specific language model focusing on NGL prediction.
Project description
AbLang-2
Addressing the antibody germline bias and its effect on language models for improved antibody design
Motivation: The versatile binding properties of antibodies have made them an extremely important class of biotherapeutics. However, therapeutic antibody development is a complex, expensive and time-consuming task, with the final antibody needing to not only have strong and specific binding, but also be minimally impacted by any developability issues. The success of transformer-based language models in protein sequence space and the availability of vast amounts of antibody sequences, has led to the development of many antibody-specific language models to help guide antibody discovery and design. Antibody diversity primarily arises from V(D)J recombination, mutations within the CDRs, and/or from a small number of mutations away from the germline outside the CDRs. Consequently, a significant portion of the variable domain of all natural antibody sequences remains germline. This affects the pre-training of antibody-specific language models, where this facet of the sequence data introduces a prevailing bias towards germline residues. This poses a challenge, as mutations away from the germline are often vital for generating specific and potent binding to a target, meaning that language models need be able to suggest key mutations away from germline.
Results: In this study, we explore the implications of the germline bias, examining its impact on both general-protein and antibody-specific language models. We develop and train a series of new antibody-specific language models optimised for predicting non-germline residues. We then compare our final model, AbLang-2, with current models and show how it suggests a diverse set of valid mutations with high cumulative probability. AbLang-2 is trained on both unpaired and paired data, and is freely available (https://github.com/oxpig/AbLang2.git).
Availability and implementation: AbLang2 is a python package available at https://github.com/oxpig/AbLang2.git.
TCRLang-Paired: The AbLang2 architecture can be initialised with model weights trained on paired TCR sequences. This model can be used in an identical way to AbLang2 on TCR sequences. The only missing functionality is the lack of the align command. The generation of sequence and residue encodings, as well as masking are all the same. For an example please see the notebook.
Install AbLang2
AbLang is freely available and can be installed with pip.
pip install ablang2
or directly from github.
pip install -U git+https://github.com/oxpig/AbLang2.git
NB: If you want to have your returned output aligned (i.e. use the argument "align=True"), you need to manually install Pandas and a version of ANARCI in the same environment. ANARCI can also be installed using bioconda; however, this version is maintained by a third party.
conda install -c bioconda anarci
AbLang2 usecases
AbLang2 can be used in different ways and for a variety of usecases. The central building blocks are the tokenizer, AbRep, and AbLang.
- Tokenizer: Converts sequences and amino acids to tokens, and vice versa
- AbRep: Generates residue embeddings from tokens
- AbLang: Generates amino acid likelihoods from tokens
import ablang2
# Download and initialise the model
ablang = ablang2.pretrained(model_to_use='ablang2-paired', random_init=False, ncpu=1, device='cpu')
seq = [
'EVQLLESGGEVKKPGASVKVSCRASGYTFRNYGLTWVRQAPGQGLEWMGWISAYNGNTNYAQKFQGRVTLTTDTSTSTAYMELRSLRSDDTAVYFCARDVPGHGAAFMDVWGTGTTVTVSS', # The heavy chain (VH) needs to be the first element
'DIQLTQSPLSLPVTLGQPASISCRSSQSLEASDTNIYLSWFQQRPGQSPRRLIYKISNRDSGVPDRFSGSGSGTHFTLRISRVEADDVAVYYCMQGTHWPPAFGQGTKVDIK' # The light chain (VL) needs to be the second element
]
# Tokenize input sequences
seqs = [f"{seq[0]}|{seq[1]}"] # Input needs to be a list, with | used to separated the VH and VL
tokenized_seq = ablang.tokenizer(seqs, pad=True, w_extra_tkns=False, device="cpu")
# Generate rescodings
with torch.no_grad():
rescoding = ablang.AbRep(tokenized_seq).last_hidden_states
# Generate logits/likelihoods
with torch.no_grad():
likelihoods = ablang.AbLang(tokenized_seq)
We have build a wrapper for specific usecases which can be explored via a the following Jupyter notebook.
Citation
@article{Olsen2024,
title={Addressing the antibody germline bias and its effect on language models for improved antibody design},
author={Tobias H. Olsen, Iain H. Moal and Charlotte M. Deane},
journal={bioRxiv},
doi={https://doi.org/10.1101/2024.02.02.578678},
year={2024}
}
Project details
Release history Release notifications | RSS feed
Download files
Download the file for your platform. If you're not sure which to choose, learn more about installing packages.
Source Distribution
Built Distribution
Filter files by name, interpreter, ABI, and platform.
If you're not sure about the file name format, learn more about wheel file names.
Copy a direct link to the current filters
File details
Details for the file ablang2-0.2.1.tar.gz.
File metadata
- Download URL: ablang2-0.2.1.tar.gz
- Upload date:
- Size: 33.9 kB
- Tags: Source
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/5.1.0 CPython/3.11.9
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
7f01bec5c5a5d5c270fa078cdd923d3a98bdc2b93538b17d46231db2d783676d
|
|
| MD5 |
5611431e004d62b12fff5fdae1763e76
|
|
| BLAKE2b-256 |
5ba562ff8f776a2732c5fe5ae07cee89c5f3d3248c07814d012f8669d024115f
|
File details
Details for the file ablang2-0.2.1-py3-none-any.whl.
File metadata
- Download URL: ablang2-0.2.1-py3-none-any.whl
- Upload date:
- Size: 38.3 kB
- Tags: Python 3
- Uploaded using Trusted Publishing? No
- Uploaded via: twine/5.1.0 CPython/3.11.9
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
eda9b550bd8d9bdf1caaac821c3951deff5ef7141d4644292c6ba09126bbd834
|
|
| MD5 |
572c82b0361bf583102f6070151d8661
|
|
| BLAKE2b-256 |
c68979e5964b73c6cf7a9b19bc8b7a9c727dedffd780086da92196cc6464d720
|