anthroab 1.0.1

AnthroAb: Human antibody language model based on RoBERTa for humanization

AnthroAb: Human Antibody Language Model

             █████  ███    ██ ████████ ██   ██ ██████   ██████      █████  ██████  
             ██   ██ ████   ██    ██    ██   ██ ██   ██ ██    ██    ██   ██ ██   ██ 
             ███████ ██ ██  ██    ██    ███████ ██████  ██    ██ ██ ███████ ██████  
             ██   ██ ██  ██ ██    ██    ██   ██ ██   ██ ██    ██    ██   ██ ██   ██ 
             ██   ██ ██   ████    ██    ██   ██ ██   ██  ██████     ██   ██ ██████

AnthroAb is a human antibody language model based on RoBERTa, specifically trained for antibody humanization tasks.

Features

• Antibody Humanization: Predict humanized versions of antibody sequences
• Sequence Infilling: Fill masked positions with human-like residues
• Mutation Suggestions: Suggest humanizing mutations for frameworks and CDRs
• Embedding Generation: Create vector representations of residues or sequences
• Dual Chain Support: Separate models for Variable Heavy (VH) and Variable Light (VL) chains

Installation

# Install from PyPI (when published)
pip install anthroab

# Or install from source
git clone https://github.com/your-username/AnthroAb
cd AnthroAb
pip install -e .

Quick Start

Antibody Sequence Humanization

import anthroab

# Humanize a heavy chain sequence
vh_sequence = "***LV*SGAEVKKPGASVKVSCKASGYTFTDYYIHWVKQRPEQGLEWIGWIDPENGDTEYAPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCARNLGPSFYFDYWGQGTLVTVSS"
humanized_vh = anthroab.predict_best_score(vh_sequence, 'H')
print(f"Humanized VH: {humanized_vh}")

# Humanize a light chain sequence
vl_sequence = "DIQMTQSPSSLSASV*DRVTITCRASQSISSYLNWYQQKPGKAPKLLIYSASTLASGVPSRFSGSGSGTDF*LTISSLQPEDFATYYCQQSYSTPRTFGQGTKVEIK"
humanized_vl = anthroab.predict_best_score(vl_sequence, 'L')
print(f"Humanized VL: {humanized_vl}")

Model Details

Architecture

• Base Model: RoBERTa (trained from scratch)
• Architecture: RobertaForMaskedLM
• Model Type: Masked Language Model for antibody sequences

Model Specifications

• Hidden Size: 768
• Number of Layers: 12
• Number of Attention Heads: 12
• Intermediate Size: 3072
• Max Position Embeddings: 192 (VH), 145 (VL)
• Vocabulary Size: 25 tokens
• Model Size: ~164 MB per model

Available Models

• VH Model: hemantn/roberta-base-humAb-vh - For Variable Heavy chains
• VL Model: hemantn/roberta-base-humAb-vl - For Variable Light chains

Citation

If you use AnthroAb in your research, please cite:

@misc{anthroab,
  author = {Hemant N},
  title = {AnthroAb: Human Antibody Language Model for Humanization},
  year = {2024},
  publisher = {Hugging Face},
  url = {https://huggingface.co/hemantn/roberta-base-humAb-vh}
}

License

This project is licensed under the MIT License - see the LICENSE file for details.

Contributing

Contributions are welcome! Please feel free to submit a Pull Request.

Acknowledgments

Note: This codebase and API design are adopted from the Sapiens model by Merck.AnthroAb maintains the same interface and functionality as Sapiens but utilizes a RoBERTa-base model trained on human antibody sequences from the OAS database (up to year 2025) for antibody humanization.

Original Sapiens Citation

David Prihoda, Jad Maamary, Andrew Waight, Veronica Juan, Laurence Fayadat-Dilman, Daniel Svozil & Danny A. Bitton (2022) BioPhi: A platform for antibody design, humanization, and humanness evaluation based on natural antibody repertoires and deep learning, mAbs, 14:1, DOI: https://doi.org/10.1080/19420862.2021.2020203

Related Projects

• Sapiens: Original antibody language model by Merck (this codebase is based on Sapiens)
• BioPhi: Antibody design and humanization platform
• OAS: Observed Antibody Space database

Support

For questions, issues, or contributions, please open an issue on the GitHub repository.