Skip to main content

Inverse folding of antibodies

Project description

AntiFold

AntiFold predicts sequences which fit into antibody variable domain structures. The tool outputs residue log-likelihoods in CSV format, and can sample sequences to a FASTA format directly. Sampled sequences show high structural agreement with experimental structures.

AntiFold is based on the ESM-IF1 model and is fine-tuned on solved and predicted antibody structures from SAbDab and OAS.

Webserver

To try AntiFold without installing it, please see our OPIG webserver: https://opig.stats.ox.ac.uk/webapps/antifold/

Install and run AntiFold

Download and install from Github source (recommended - latest release)

conda create --name antifold python=3.10 -y && conda activate antifold
conda install -c conda-forge pytorch
git clone https://github.com/oxpig/AntiFold && cd AntiFold
pip install .

GPU only: install using environment.yml

conda create env -f environment.yml
python -m pip install .

Depending on your CUDA version you may need to change the dependency pytorch-cuda=12.1 in the environment.yml file. Detailed instructions on how to correctly install pytorch for your system can be found here

Run AntiFold (inverse-folding probabilities, sample sequences)

# Run AntiFold on single PDB/CIF file
# Nb: Assumes first chain heavy, second chain light
python antifold/main.py \
    --pdb_file data/pdbs/6y1l_imgt.pdb

# Antibody-antigen complex
python antifold/main.py \
    --pdb_file data/antibody_antigen/3hfm.pdb \
    --heavy_chain H \
    --light_chain L \
    --antigen_chain Y

# Nanobody or single-chain
python antifold/main.py \
    --pdb_file data/nanobody/8oi2_imgt.pdb \
    --nanobody_chain B

# Folder of PDB/CIFs
# Nb: Assumes first chain heavy, second light
python antifold/main.py \
    --pdb_dir data/pdbs

# Specify chains to run in a CSV file (e.g. antibody-antigen complex)
python antifold/main.py \
    --pdb_dir data/antibody_antigen \
    --pdbs_csv data/antibody_antigen.csv

# Sample sequences 10x
python antifold/main.py \
    --pdb_file data/pdbs/6y1l_imgt.pdb \
    --heavy_chain H \
    --light_chain L \
    --num_seq_per_target 10 \
    --sampling_temp "0.2" \
    --regions "CDR1 CDR2 CDR3"

# Run all chains with ESM-IF1 model weights
python antifold/main.py \
    --pdb_dir data/pdbs \
    --esm_if1_mode

Jupyter notebook

Notebook: notebook.ipynb

Colab: Open In Colab

import antifold
import antifold.main

# Load model
model = antifold.main.load_model()

# PDB directory
pdb_dir = "data/pdbs"

# Assumes first chain heavy, second chain light
pdbs_csv = antifold.main.generate_pdbs_csv(pdb_dir, max_chains=2)

# Sample from PDBs
df_logits_list = antifold.main.get_pdbs_logits(
    model=model,
    pdbs_csv_or_dataframe=pdbs_csv,
    pdb_dir=pdb_dir,
)

# Output log probabilites
df_logits_list[0]

Input parameters

Required parameters:

Input PDBs should be antibody variable domain structures (IMGT positions 1-128).

If no chains are specified, the first two chains will be assumed to be heavy light.
If custom_chain_mode is set, all (10) chains will be run.

- Option 1: PDB file (--pdb_file). We recommend specifying heavy and light chain (--heavy_chain and --light_chain)
- Option 2: PDB folder (--pdb_dir) + CSV file specifying chains (--pdbs_csv)
- Option 3: PDB folder, infer 1st chain heavy, 2nd chain light

Parameters for generating new sequences:

PDBs should be IMGT annotated for the sequence sampling regions to be valid.

- Number of sequences to generate (--num_seq_per_target)
- Region to mutate (--region) based on inverse folding probabilities. Select from list in IMGT_dict (e.g. 'CDRH1 CDRH2 CDRH3')
- Sampling temperature (--sampling_temp) controls generated sequence diversity, by scaling the inverse folding probabilities before sampling. Temperature = 1 means no change, while temperature ~ 0 only samples the most likely amino-acid at each position (acts as argmax).

Optional parameters:

- Multi-chain mode for including antigen or other chains (--custom_chain_mode)
- Extract latent representations of PDB within model (--extract_embeddings)
- Use ESM-IF1 instead of AntiFold model weights (--esm_if1_mode), enables custom_chain_mode

Example output

For example webserver output, see: https://opig.stats.ox.ac.uk/webapps/antifold/results/example_job/

Output CSV with residue log-probabilities: Residue probabilities: 6y1l_imgt.csv

  • pdb_pos - PDB residue number
  • pdb_chain - PDB chain
  • aa_orig - PDB residue (e.g. 112)
  • aa_pred - Top predicted residue by AntiFold (i.e. argmax) for this position
  • pdb_posins - PDB residue number with insertion code (e.g. 112A)
  • perplexity - Inverse folding tolerance (higher is more tolerant) to mutations. See paper for more details.
  • Amino-acids - Inverse folding scores (log-likelihood) for the given position
pdb_pos,pdb_chain,aa_orig,aa_pred,pdb_posins,perplexity,A,C,D,E,F,G,H,I,K,L,M,N,P,Q,R,S,T,V,W,Y
2,H,V,M,2,1.6488,-4.9963,-6.6117,-6.3181,-6.3243,-6.7570,-4.2518,-6.7514,-5.2540,-6.8067,-5.8619,-0.0904,-6.5493,-4.8639,-6.6316,-6.3084,-5.1900,-5.0988,-3.7295,-8.0480,-7.3236
3,H,Q,Q,3,1.3889,-10.5258,-12.8463,-8.4800,-4.7630,-12.9094,-11.0924,-5.6136,-10.9870,-3.1119,-8.1113,-9.4382,-6.2246,-13.3660,-0.0701,-4.9957,-10.0301,-6.8618,-7.5810,-13.6721,-11.4157
4,H,L,L,4,1.0021,-13.3581,-12.6206,-17.5484,-12.4801,-9.8792,-13.6382,-14.8609,-13.9344,-16.4080,-0.0002,-9.2727,-16.6532,-14.0476,-12.5943,-15.4559,-16.9103,-17.0809,-10.5670,-13.5334,-13.4324
...

Output FASTA file with sampled sequences: 6y1l_imgt.fasta

  • T: Temperature used for design
  • score: average log-odds of residues in the sampled region
  • global_score: average log-odds of all residues (IMGT positions 1-128)
  • regions: regions selected for design
  • seq_recovery: # mutations / total sequence length
  • mutations: # mutations from original PDB sequence
>6y1l_imgt , score=0.2934, global_score=0.2934, regions=['CDR1', 'CDR2', 'CDRH3'], model_name=AntiFold, seed=42
VQLQESGPGLVKPSETLSLTCAVSGYSISSGYYWGWIRQPPGKGLEWIGSIYHSGSTYYN
PSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAGLTQSSHNDANWGQGTLVTVSS/V
LTQPPSVSAAPGQKVTISCSGSSSNIGNNYVSWYQQLPGTAPKRLIYDNNKRPSGIPDRF
SGSKSGTSATLGITGLQTGDEADYYCGTWDSSLNPVFGGGTKLEIKR
> T=0.20, sample=1, score=0.3930, global_score=0.1869, seq_recovery=0.8983, mutations=12
VQLQESGPGLVKPSETLSLTCAVSGASITSSYYWGWIRQPPGKGLEWIGSIYYSGSTYYN
PSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAGLYGSPWSNPYWGQGTLVTVSS/V
LTQPPSVSAAPGQKVTISCSGSSSNIGNNYVSWYQQLPGTAPKRLIYDNNKRPSGIPDRF
SGSKSGTSATLGITGLQTGDEADYYCGTWDSSLNPVFGGGTKLEIKR
...

Usage

usage:
    # Predict on example PDBs in folder
python antifold/main.py \
    --pdb_file data/antibody_antigen/3hfm.pdb \
    --heavy_chain H \
    --light_chain L \
    --antigen_chain Y # Optional

Predict inverse folding probabilities for antibody variable domain, and sample sequences with maintained fold.
PDB structures should be IMGT-numbered, paired heavy and light chain variable domains (positions 1-128).

For IMGT numbering PDBs use SAbDab or https://opig.stats.ox.ac.uk/webapps/sabdab-sabpred/sabpred/anarci/

options:
  -h, --help            show this help message and exit
  --pdb_file PDB_FILE   Input PDB file (for single PDB predictions)
  --heavy_chain HEAVY_CHAIN
                        Ab heavy chain (for single PDB predictions)
  --light_chain LIGHT_CHAIN
                        Ab light chain (for single PDB predictions)
  --antigen_chain ANTIGEN_CHAIN
                        Antigen chain (optional)
  --pdbs_csv PDBS_CSV   Input CSV file with PDB names and H/L chains (multi-PDB predictions)
  --pdb_dir PDB_DIR     Directory with input PDB files (multi-PDB predictions)
  --out_dir OUT_DIR     Output directory
  --regions REGIONS     Space-separated regions to mutate. Default 'CDR1 CDR2 CDR3H'
  --num_seq_per_target NUM_SEQ_PER_TARGET
                        Number of sequences to sample from each antibody PDB (default 0)
  --sampling_temp SAMPLING_TEMP
                        A string of temperatures e.g. '0.20 0.25 0.50' (default 0.20). Sampling temperature for amino acids. Suggested values 0.10, 0.15, 0.20, 0.25, 0.30. Higher values will lead to more diversity.
  --limit_variation     Limit variation to as many mutations as expected from temperature sampling
  --extract_embeddings  Extract per-residue embeddings from AntiFold / ESM-IF1
  --custom_chain_mode   Run all specified chains (for antibody-antigen complexes or any combination of chains)
  --exclude_heavy       Exclude heavy chain from sampling
  --exclude_light       Exclude light chain from sampling
  --batch_size BATCH_SIZE
                        Batch-size to use
  --num_threads NUM_THREADS
                        Number of CPU threads to use for parallel processing (0 = all available)
  --seed SEED           Seed for reproducibility
  --model_path MODEL_PATH
                        Alternative model weights (default models/model.pt). See --use_esm_if1_weights flag to use ESM-IF1 weights instead of AntiFold
  --esm_if1_mode        Use ESM-IF1 weights instead of AntiFold
  --verbose VERBOSE     Verbose printing

IMGT regions dict

Used to specify which regions to mutate in an IMGT numbered PDB

IMGT_dict = {
    "all": range(1, 128 + 1),
    "allH": range(1, 128 + 1),
    "allL": range(1, 128 + 1),
    "FWH": list(range(1, 26 + 1)) + list(range(40, 55 + 1)) + list(range(66, 104 + 1)),
    "FWL": list(range(1, 26 + 1)) + list(range(40, 55 + 1)) + list(range(66, 104 + 1)),
    "CDRH": list(range(27, 39)) + list(range(56, 65 + 1)) + list(range(105, 117 + 1)),
    "CDRL": list(range(27, 39)) + list(range(56, 65 + 1)) + list(range(105, 117 + 1)),
    "FW1": range(1, 26 + 1),
    "FWH1": range(1, 26 + 1),
    "FWL1": range(1, 26 + 1),
    "CDR1": range(27, 39),
    "CDRH1": range(27, 39),
    "CDRL1": range(27, 39),
    "FW2": range(40, 55 + 1),
    "FWH2": range(40, 55 + 1),
    "FWL2": range(40, 55 + 1),
    "CDR2": range(56, 65 + 1),
    "CDRH2": range(56, 65 + 1),
    "CDRL2": range(56, 65 + 1),
    "FW3": range(66, 104 + 1),
    "FWH3": range(66, 104 + 1),
    "FWL3": range(66, 104 + 1),
    "CDR3": range(105, 117 + 1),
    "CDRH3": range(105, 117 + 1),
    "CDRL3": range(105, 117 + 1),
    "FW4": range(118, 128 + 1),
    "FWH4": range(118, 128 + 1),
    "FWL4": range(118, 128 + 1),
}

Citing this work

The code and data in this package is based on the following paper AntiFold. If you use it, please cite:

@misc{antifold,
      title={AntiFold: Improved antibody structure-based design using inverse folding},
      author={Magnus Haraldson Høie and Alissa Hummer and Tobias H. Olsen and Broncio Aguilar-Sanjuan and Morten Nielsen and Charlotte M. Deane},
      year={2024},
      eprint={2405.03370},
      archivePrefix={arXiv},
      primaryClass={q-bio.BM}
}

Project details


Download files

Download the file for your platform. If you're not sure which to choose, learn more about installing packages.

Source Distribution

antifold-0.3.1.tar.gz (65.1 kB view details)

Uploaded Source

Built Distribution

If you're not sure about the file name format, learn more about wheel file names.

antifold-0.3.1-py3-none-any.whl (78.2 kB view details)

Uploaded Python 3

File details

Details for the file antifold-0.3.1.tar.gz.

File metadata

  • Download URL: antifold-0.3.1.tar.gz
  • Upload date:
  • Size: 65.1 kB
  • Tags: Source
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/5.1.1 CPython/3.12.4

File hashes

Hashes for antifold-0.3.1.tar.gz
Algorithm Hash digest
SHA256 bb4b4fa5c31f793e7575a8bf479ae5cf4d6c7ac09951b0af1ca98957bb1097b3
MD5 eabb810405cf521e8ad22f4c3fc7bc48
BLAKE2b-256 2c4848847175e97d1f8e0027afc9e4c0c1b9846543efc6b8adfefeed240ae47b

See more details on using hashes here.

File details

Details for the file antifold-0.3.1-py3-none-any.whl.

File metadata

  • Download URL: antifold-0.3.1-py3-none-any.whl
  • Upload date:
  • Size: 78.2 kB
  • Tags: Python 3
  • Uploaded using Trusted Publishing? No
  • Uploaded via: twine/5.1.1 CPython/3.12.4

File hashes

Hashes for antifold-0.3.1-py3-none-any.whl
Algorithm Hash digest
SHA256 5b0cb1b314f086e13f6257fe5b4a4a15153effe7b2b9fc7156950183aa33b4dc
MD5 6e781c56c9b05966852f6ee0611a8053
BLAKE2b-256 c77be82963bd1fe9e407869a7fad285d79d1d96c5ae8ec7caad0f0b84e4b5467

See more details on using hashes here.

Supported by

AWS Cloud computing and Security Sponsor Datadog Monitoring Depot Continuous Integration Fastly CDN Google Download Analytics Pingdom Monitoring Sentry Error logging StatusPage Status page