AtlasFold
The Atlas family is a collection of open protein models for sequence representation and structure prediction. AtlasLM is a protein language model (PLM), while AtlasFold and AtlasFold-M are trainable PLM-based models for protein folding and co-folding, respectively.
AtlasFold achieves state-of-the-art accuracy among protein language model-based folding methods. AtlasFold and AtlasFold-M predict structures without an MSA search. This repository provides pretrained models, training and inference code, staged training configurations, and preprocessing workflows for monomer and multimer folding.
Installation
AtlasFold requires Python 3.10 or later. A CUDA GPU is recommended for structure prediction.
Install the inference dependencies from PyPI:
pip install "atlasfold[fold,cuequiv]"
To use AtlasLM as a standalone protein language model:
pip install atlasfold
To install the latest development version from GitHub:
git clone https://github.com/SeonghwanSeo/atlasfold.git
cd atlasfold
pip install -e ".[fold,cuequiv]"
AtlasFold supports cuEquivariance kernels for faster inference. For systems without compatible NVIDIA CUDA hardware, install atlasfold[fold] instead.
Running your first prediction
For a monomer, save one protein sequence per FASTA record:
>protein_a
MKTAYIAKQRQISFVKSHFSRQDILDLWIYHTQGYFPD
>protein_b
FNPVGVAFKGNNGKYLSRIHRSGIDYTEFAKDNTD
Then run:
atlasfold monomer --input-fasta monomer.fasta --out-dir predictions/monomer/
For a protein complex, use one FASTA record per complex and separate chains with ::
>complex_a
MKTAYIAKQRQISFVKSHFS:GGHVDHGKSTTTGHLIYK
>complex_b
MKEGFYWIQHNGRVQVAYYTHGVTEDLETGQTIIGVWHLTQGDDICHNGEAEILAGPLEPPI:MKEGFYWIQHNGRVQVA
YYTHGVTEDLETGQTIIGVWHLTQGDDICHNGEAEILAGPLEPPI
atlasfold multimer --input-fasta multimer.fasta --out-dir predictions/multimer/
Template-assisted inference for AtlasFold-M is not supported by the current runner or CLI.
The repository entry point provides the same interface:
python run_atlasfold.py monomer --input-fasta monomer.fasta --out-dir predictions/monomer/
python run_atlasfold.py multimer --input-fasta multimer.fasta --out-dir predictions/multimer/
Both AtlasFold and AtlasFold-M support batched inference with multiple FASTA records, enabling high-throughput structure prediction.
Run atlasfold monomer --help or atlasfold multimer --help for all options, and see the inference guide for batching, sampling, confidence values, and output formats.
Performance and GPU memory
Peak GPU memory grows with total residue length when generating five diffusion samples.
| Total residues | AtlasFold | AtlasFold-M |
|---|---|---|
| 256 | 7.22 GiB | 7.31 GiB |
| 512 | 8.80 GiB | 9.07 GiB |
| 1,024 | 15.02 GiB | 16.05 GiB |
| 1,536 | 25.36 GiB | 27.63 GiB |
| 2,048 | 39.81 GiB | 43.83 GiB |
For multi-target workloads, batched inference substantially increases throughput. With five diffusion samples and up to 4,096 residues processed per batch:
| Workload | Unbatched | Batched | Throughput gain |
|---|---|---|---|
| AtlasFold, 64-residue monomers | 0.775 sequences/s | 9.663 sequences/s | 12.5× |
| AtlasFold-M, 256-residue complexes | 0.149 complexes/s | 0.314 complexes/s | 2.1× |
Measurements were collected on a single NVIDIA B200 using PyTorch 2.10.0, CUDA 12.8, and cuEquivariance 0.10.0. See the performance guide for the complete memory and runtime measurements.
Python API
Structure prediction
from atlasfold.pretrained import get_runner, load_model
model = load_model("atlasfold", device="cuda")
runner = get_runner(model)
result = runner.fold(
"protein_a",
"MKTAYIAKQRQISFVKSHFSRQDILDLWIYHTQGYFPD",
num_samples=5,
)
print(result.best.avg_plddt, result.best.ptm)
with open("protein_a.pdb", "w") as handle:
handle.write(result.best.to_pdb())
with open("protein_a.cif", "w") as handle:
handle.write(result.best.to_mmcif())
Use load_model("atlasfold-m", device="cuda") for a complex and pass a list of chain sequences to runner.fold(). The Python API defaults to CPU if device is omitted; the CLI selects CUDA automatically when available.
Protein language model
import torch
from atlaslm import load_model
model = load_model("atlaslm-3b", device="cuda", dtype=torch.bfloat16)
output = model.embed_sequences(
["MKTAYIAKQRQISFVKSHFSRQDILDLWIYHTQGYFPD"],
return_hidden_states=True,
)
print(output.embeddings.shape)
print(len(output.hidden_states))
Pass return_attentions=True to return attention maps. Attention tensors grow quadratically with sequence length and can require substantially more memory.
Available models
| Model | Parameters | Weight download | Use | Weights |
|---|---|---|---|---|
| AtlasLM-600M | 575M | 1.07 GiB | Protein sequence representations | SeonghwanSeo/atlaslm-600m-base |
| AtlasLM-3B | 3.06B | 5.71 GiB | Protein sequence representations and AtlasFold backbone | SeonghwanSeo/atlaslm-3b-base |
| AtlasFold | 215M + AtlasLM-3B | 0.80 GiB + AtlasLM-3B | Monomer structure prediction | SeonghwanSeo/atlasfold-260703 |
| AtlasFold-M | 220M + AtlasLM-3B | 0.82 GiB + AtlasLM-3B | Protein-complex structure prediction | SeonghwanSeo/atlasfold-m-260725 |
AtlasLM-600M is deprecated now that ESMC-600M is available for commercial use. AtlasLM-3B is the recommended AtlasLM checkpoint.
Evaluation
Evaluation protocols and results for AtlasFold and AtlasFold-M are provided in the benchmark documentation. The associated prediction structures and evaluation artifacts are available from the release folder below.
Checkpoints, data, and benchmark artifacts
Large release artifacts are hosted in the AtlasFold Google Drive folder:
| Artifact | Contents |
|---|---|
| Intermediate checkpoints | AtlasLM pretraining checkpoints and AtlasFold/AtlasFold-M staged training checkpoints |
| Structural datasets | Processed monomer and multimer training and validation data |
| Benchmark artifacts | CAMEO22, CASP14, CASP15 and FoldBench results |
Training
Install the training dependencies with pip install -e ".[fold,train,cuequiv]". AtlasFold monomer training uses four progressively longer crop stages, and AtlasFold-M fine-tuning uses three stages initialized from the monomer model. See the training guide for data setup, released intermediate checkpoints, complete commands, and configuration overrides, and the data guide for the released dataset layout and provenance.
Citation
@article{seo2026atlasfold,
author = {Seo, Seonghwan and Kim, Hyeongwoo and Moon, Seokhyun and Kim, Woo Youn and {Team KAIST}},
title = {AtlasFold: Protein structure prediction with metagenomic-scale language models},
year = {2026},
doi = {10.64898/2026.09.04.749352},
URL = {https://www.biorxiv.org/content/10.64898/2026.09.04.749352v2},
journal = {bioRxiv}
}
Acknowledgements
This project was developed as part of the K-Fold initiative supported by the Ministry of Science and ICT (MSIT) of the Republic of Korea. The K-Fold project for biomolecular complex prediction is currently under active development with numerous contributors at KAIST and will be released soon!
I would like to thank Dr. Hyeongwoo Kim, Dr. Seokhyun Moon, and Prof. Woo Youn Kim for their guidance and support during the development of AtlasFold.
This project is built upon the pioneering works of Google DeepMind, Meta AI, OpenFold Consortium, and EvolutionaryScale in the fields of biomolecular language modeling and structure prediction. I am deeply grateful to the open-source community for advancing the fields of biomolecular language modeling and structure prediction.
Foundations of AtlasLM:
- ESM2: Lin, Zeming, et al. "Evolutionary-scale prediction of atomic-level protein structure with a language model." Science 379.6637 (2023): 1123-1130.
- ESM3: Hayes, Thomas, et al. "Simulating 500 million years of evolution with a language model." Science 387.6736 (2025): 850-858.
- ESMC: ESM Team. "ESM Cambrian: Revealing the mysteries of proteins with unsupervised learning." EvolutionaryScale Website, December 4, 2024. https://evolutionaryscale.ai/blog/esm-cambrian.
Foundations of AtlasFold:
- AlphaFold2: Jumper, John, et al. "Highly accurate protein structure prediction with AlphaFold." Nature 596.7873 (2021): 583-589.
- OpenFold: Ahdritz, Gustaf, et al. "OpenFold: retraining AlphaFold2 yields new insights into its learning mechanisms and capacity for generalization." Nature Methods 21.8 (2024): 1514-1524.
- ESMFold: Lin, Zeming, et al. "Evolutionary-scale prediction of atomic-level protein structure with a language model." Science 379.6637 (2023): 1123-1130.
- AlphaFold3: Abramson, Josh, et al. "Accurate structure prediction of biomolecular interactions with AlphaFold 3." Nature 630.8016 (2024): 493-500.
- SimpleFold: Wang, Yuyang, et al. "SimpleFold: Folding proteins is simpler than you think." arXiv preprint arXiv:2509.18480 (2025).
- ESMFold2: Candido, Salvatore, et al. "Language Modeling Materializes a World Model of Protein Biology." bioRxiv preprint (2026).
License
The source code, model weights, and released datasets are licensed under the MIT License.
Download files
Download the file for your platform. If you're not sure which to choose, learn more about installing packages.
Source Distribution
Built Distribution
Filter files by name, interpreter, ABI, and platform.
If you're not sure about the file name format, learn more about wheel file names.
Copy a direct link to the current filters
File details
Details for the file atlasfold-1.0.0.tar.gz.
File metadata
- Download URL: atlasfold-1.0.0.tar.gz
- Upload date:
- Size: 159.9 kB
- Tags: Source
- Uploaded using Trusted Publishing? No
- Uploaded via:
uv/0.9.7
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
04b455f7327912774473eba06dc226813ec9b617e5a30adca13328ff38a90f0d
|
|
| MD5 |
a7a9d34d907dfc2427038e5eb6f58b3d
|
|
| BLAKE2b-256 |
d28fc932f240333b75768885fd6d3939e7c9efcdccd13feb3275d6429b3d81e4
|
File details
Details for the file atlasfold-1.0.0-py3-none-any.whl.
File metadata
- Download URL: atlasfold-1.0.0-py3-none-any.whl
- Upload date:
- Size: 200.3 kB
- Tags: Python 3
- Uploaded using Trusted Publishing? No
- Uploaded via:
uv/0.9.7
File hashes
| Algorithm | Hash digest | |
|---|---|---|
| SHA256 |
00871b46d6aa870f7b1d806153082f18df14be4dbda49f2b6da8bb66318cbcd3
|
|
| MD5 |
1083b6e105081c41b4ffc209caf24989
|
|
| BLAKE2b-256 |
c14cc7f4f7ed2d968228e38b871da38a9de9f77fbc4245def98b273a02e2822e
|